RegulonDB RegulonDB 10.8: Gene Form
   

flgE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

flgE flgF flgD TSS_1345 TSS_1345 TSS_1344 TSS_1344

Gene      
Name: flgE    Texpresso search in the literature
Synonym(s): ECK1061, G361, b1076, flaK
Genome position(nucleotides): 1132574 --> 1133782 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.53
External database links:  
ASAP:
ABE-0003647
CGSC:
766
ECHOBASE:
EB4017
OU-MICROARRAY:
b1076
PortEco:
flgE
STRING:
511145.b1076
COLOMBOS: flgE


Product      
Name: flagellar hook protein FlgE
Synonym(s): FlaK, FlgE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,cell projection
Molecular weight: 42.045
Isoelectric point: 4.253
Motif(s):
 
Type Positions Sequence
173 -> 283 SNADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNANGTLVDGAMANNIATGAINGAEPATFSLSFLNSMQQNTGANNIVATTQNGY
324 -> 401 GLASEGDNVWSATQSSGVALLGTAGTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNL
2 -> 402 AFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLTGYPATGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPLPTVTPFSASNADSYNKKGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPNSIAKTATTLEFNANGTLVDGAMANNIATGAINGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGDLVSYQINDDGTVVGNYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTAGTGNFGTLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR
4 -> 33 SQAVSGLNAAATNLDVIGNNIANSATYGFK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009288 - bacterial-type flagellum
GO:0009424 - bacterial-type flagellum hook
GO:0009425 - bacterial-type flagellum basal body
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0071978 - bacterial-type flagellum-dependent swarming motility
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G361-MONOMER
ECOLIWIKI:
b1076
INTERPRO:
IPR010930
INTERPRO:
IPR037925
INTERPRO:
IPR037058
INTERPRO:
IPR020013
INTERPRO:
IPR001444
INTERPRO:
IPR011491
INTERPRO:
IPR019776
PFAM:
PF00460
PFAM:
PF06429
PFAM:
PF07559
PRIDE:
P75937
PRODB:
PRO_000022641
PROSITE:
PS00588
REFSEQ:
NP_415594
SMR:
P75937
SWISSMODEL:
P75937
UNIPROT:
P75937


Operon      
Name: flgBCDEFGHIJ         
Operon arrangement:
Transcription unit        Promoter
flgBCDEFGHIJ


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1344 1131956 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1345 1132384 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB