RegulonDB RegulonDB 10.8: Gene Form
   

yaeP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tilS yaeQ rof yaeP arfB CRP yaeQp yaeQp TSS_395 TSS_395 TSS_394 TSS_394 yaeQp6 yaeQp6 yaePp yaePp TSS_393 TSS_393 yaeQp3 yaeQp3

Gene      
Name: yaeP    Texpresso search in the literature
Synonym(s): ECK0189, G372, b4406
Genome position(nucleotides): 213925 <-- 214125 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.75
External database links:  
ASAP:
ABE-0047214
ECHOBASE:
EB3013
OU-MICROARRAY:
b4406
PortEco:
yaeP
STRING:
511145.b4406
COLOMBOS: yaeP


Product      
Name: UPF0253 family protein YaeP
Synonym(s): YaeP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.214
Isoelectric point: 4.19
Motif(s):
 
Type Positions Sequence
1 -> 65 MEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAADDALSEAVREKAAYAAANLLVSDYVN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-741
ECOLIWIKI:
b4406
INTERPRO:
IPR009624
PFAM:
PF06786
PRIDE:
P0A8K5
PRODOM:
PD054643
REFSEQ:
YP_026160
SMR:
P0A8K5
UNIPROT:
P0A8K5


Operon      
Name: yaeP-rof         
Operon arrangement:
Transcription unit        Promoter
yaeP-rof


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaeQp3 214088 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_393 214163 reverse nd [RS-EPT-CBR] [2]
  promoter yaeQp6 214195 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_394 214197 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_395 214269 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB