RegulonDB RegulonDB 10.8: Gene Form
   

fliJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliI fliK fliL fliJ FlhDC FlhDC fliLp2 fliLp2 fliLp1 fliLp1

Gene      
Name: fliJ    Texpresso search in the literature
Synonym(s): ECK1940, G378, b1942, flaO
Genome position(nucleotides): 2017946 --> 2018389 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.58
External database links:  
ASAP:
ABE-0006462
CGSC:
762
ECHOBASE:
EB4164
OU-MICROARRAY:
b1942
PortEco:
fliJ
STRING:
511145.b1942
COLOMBOS: fliJ


Product      
Name: flagellar biosynthesis protein FliJ
Synonym(s): FlaO, FliJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cell projection
Molecular weight: 17.307
Isoelectric point: 8.463
Motif(s):
 
Type Positions Sequence
8 -> 8 A
19 -> 141 EDAARLLGEMRRGCQQAEEQLKMLIDYQNEYRNNLNSDMSAGITSNRWINYQQFIQTLEKAITQHRQQLNQWTQKVDIALNSWREKKQRLQAWQTLQERQSTAALLAENRLDQKKMDEFAQRA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0009288 - bacterial-type flagellum
molecular_function GO:0005515 - protein binding
GO:0003774 - motor activity
biological_process GO:0015031 - protein transport
GO:0006935 - chemotaxis
GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0044781 - bacterial-type flagellum organization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9656N
ECOCYC:
G378-MONOMER
ECOLIWIKI:
b1942
INTERPRO:
IPR012823
INTERPRO:
IPR018006
MINT:
MINT-1258288
PFAM:
PF02050
PRIDE:
P52613
PRINTS:
PR01004
PRODB:
PRO_000022661
REFSEQ:
NP_416452
SMR:
P52613
UNIPROT:
P52613


Operon      
Name: fliFGHIJK         
Operon arrangement:
Transcription unit        Promoter
fliFGHIJK
fliFGHIJK


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC
Repressed by: CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB