RegulonDB RegulonDB 10.7: Gene Form
   

maa gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

maa ylaC hha ylaCp ylaCp

Gene      
Name: maa    Texpresso search in the literature
Synonym(s): ECK0453, G58, b0459, ylaD
Genome position(nucleotides): 479367 <-- 479918 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.37
External database links:  
ASAP:
ABE-0001591
ECHOBASE:
EB3990
OU-MICROARRAY:
b0459
PORTECO:
maa
REGULONDB:
b0459
STRING:
511145.b0459
M3D: maa
COLOMBOS: maa
PortEco: b0459


Product      
Name: maltose O-acetyltransferase
Synonym(s): Maa, YlaD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.096
Isoelectric point: 6.664
Motif(s):
 
Type Positions Sequence
7 -> 57 KMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQV
92 -> 109 CPIRIGDNCMLAPGVHIY
2 -> 183 STEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARIIKKL
129 -> 164 PVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0016740 - transferase activity
GO:0016407 - acetyltransferase activity
GO:0008925 - maltose O-acetyltransferase activity
GO:0042802 - identical protein binding
Note(s): Note(s): ...[more].
Reference(s): [1] Dippel R., et al., 2005
External database links:  
DIP:
DIP-10140N
ECOCYC:
MALTACETYLTRAN-MONOMER
ECOLIWIKI:
b0459
INTERPRO:
IPR018357
INTERPRO:
IPR024688
INTERPRO:
IPR011004
INTERPRO:
IPR001451
MODBASE:
P77791
PDB:
1OCX
PFAM:
PF12464
PFAM:
PF14602
PRIDE:
P77791
PRODB:
PRO_000023143
PROSITE:
PS00101
PROTEINMODELPORTAL:
P77791
REFSEQ:
NP_414992
SMART:
SM01266
SMR:
P77791
UNIPROT:
P77791


Operon      
Name: maa         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Dippel R., Boos W., 2005, The maltodextrin system of Escherichia coli: metabolism and transport., J Bacteriol 187(24):8322-31


RegulonDB