RegulonDB RegulonDB 10.8: Gene Form
   

yaaX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thrC yaaA yaaX terminator anti-anti-terminator anti-terminator yaaXp4 yaaXp4 TSS_16 TSS_16

Gene      
Name: yaaX    Texpresso search in the literature
Synonym(s): ECK0005, G6081, b0005
Genome position(nucleotides): 5234 --> 5530 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.87
External database links:  
ASAP:
ABE-0000015
ECHOBASE:
EB4127
OU-MICROARRAY:
b0005
PortEco:
yaaX
STRING:
511145.b0005
COLOMBOS: yaaX


Product      
Name: DUF2502 domain-containing protein YaaX
Synonym(s): YaaX
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 11.355
Isoelectric point: 10.774
Motif(s):
 
Type Positions Sequence
1 -> 23 MKKMQSIVLALSLVLVAPMAAQA
25 -> 71 EITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHLH
24 -> 98 AEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G6081-MONOMER
ECOLIWIKI:
b0005
INTERPRO:
IPR019638
PFAM:
PF10697
PRIDE:
P75616
REFSEQ:
NP_414546
UNIPROT:
P75616


Operon      
Name: yaaX         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_16 4241 forward nd [RS-EPT-CBR] [2]
  promoter yaaXp4 5030 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB