RegulonDB RegulonDB 10.8: Gene Form
   

yaaW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yaaW    Texpresso search in the literature
Synonym(s): ECK0011, G6082, b0011
Genome position(nucleotides): 10643 <-- 11356 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.84
External database links:  
ASAP:
ABE-0000037
ECHOBASE:
EB4086
OU-MICROARRAY:
b0011
PortEco:
yaaW
STRING:
511145.b0011
COLOMBOS: yaaW


Product      
Name: putative enzyme-specific chaperone YaaW
Synonym(s): YaaW
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 26.665
Isoelectric point: 9.926
Motif(s):
 
Type Positions Sequence
5 -> 39 YLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRL
58 -> 220 QHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKADKEMSTFEIEQQLLEQFLRNTWKKMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAKGVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIP
190 -> 190 L

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Tutukina MN., et al., 2007
External database links:  
DIP:
DIP-11163N
ECOCYC:
G6082-MONOMER
ECOLIWIKI:
b0011
INTERPRO:
IPR021150
INTERPRO:
IPR025217
PFAM:
PF03981
PFAM:
PF13099
PRIDE:
P75617
REFSEQ:
NP_414552
SMR:
P75617
UNIPROT:
P75617


Operon      
Name: yaaW         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaaWp3 11542 reverse Similarity to the consensus
Read more >
[ICWHO] [2]



RegulonDB