RegulonDB RegulonDB 10.7: Gene Form
   

insB-1 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nhaR insAB-1 insB-1 insA-1 rpsT terminator anti-terminator anti-anti-terminator TSS_48 TSS_48 TSS_47 TSS_47 TSS_46 TSS_46 TSS_45 (cluster) TSS_45 (cluster) TSS_44 (cluster) TSS_44 (cluster)

Gene      
Name: insB-1    Texpresso search in the literature
Synonym(s): ECK0022, G6085, b0021
Genome position(nucleotides): 19811 <-- 20314 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.56
External database links:  
ASAP:
ABE-0000075
OU-MICROARRAY:
b0021
PORTECO:
insB-1
REGULONDB:
b0021
STRING:
511145.b3445
M3D: insB-1
COLOMBOS: insB-1
PortEco: b0021


Product      
Name: IS1 protein InsB
Synonym(s): InsB-1
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.565
Isoelectric point: 10.657
Motif(s):
 
Type Positions Sequence
37 -> 167 VIVCAEMDEQWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7762-MONOMER
ECOLIWIKI:
b0021
ECOO157CYC:
Z1632-MONOMER
ECOO157CYC:
Z1192-MONOMER
ECOO157CYC:
Z1123-MONOMER
ECOO157CYC:
Z5491-MONOMER
ECOO157CYC:
Z1562-MONOMER
INTERPRO:
IPR005063
PFAM:
PF03400
PRIDE:
P0CF25
PROTEINMODELPORTAL:
P0CF25
REFSEQ:
NP_414562
UNIPROT:
P0CF25


Operon      
Name: insAB-1A-1B-1         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_44 (cluster) 20342 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_45 (cluster) 20678 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_46 20910 reverse nd [RS-EPT-CBR] [1]
  transcriptional_attenuator anti-anti-terminator 20912 20935 forward nd [ICA] [2]
  transcriptional_attenuator anti-terminator 20912 20955 forward nd [ICA] [2]
  transcriptional_attenuator terminator 20937 20982 forward nd [ICA] [2]
  promoter TSS_47 21020 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_48 21045 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICA] Inferred by computational analysis



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Merino E, Yanofsky C., 2005, Transcription attenuation: a highly conserved regulatory strategy used by bacteria., Trends Genet. 2005 May;21(5):260-4.


RegulonDB