RegulonDB RegulonDB 10.7: Gene Form
   

yaaY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ribF rpsT yaaY DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp anti-anti-terminator anti-terminator terminator terminator anti-terminator anti-anti-terminator TSS_65 (cluster) TSS_65 (cluster) TSS_64 TSS_64 TSS_63 TSS_63 TSS_62 TSS_62 ileSp3 ileSp3 TSS_60 TSS_60 TSS_59 TSS_59 ileSp2 ileSp2 TSS_58 (cluster) TSS_58 (cluster) ileSp1 ileSp1 ribFp ribFp rpsTp1 rpsTp1 TSS_56 (cluster) TSS_56 (cluster) TSS_55 TSS_55 TSS_54 TSS_54 TSS_53 TSS_53 rpsTp2 rpsTp2 TSS_51 TSS_51 TSS_50 TSS_50 TSS_49 TSS_49 TSS_48 TSS_48 TSS_47 TSS_47 TSS_46 TSS_46

Gene      
Name: yaaY    Texpresso search in the literature
Synonym(s): ECK0025, G6087, b0024
Genome position(nucleotides): 21181 --> 21399 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.86
External database links:  
ASAP:
ABE-0000089
ECHOBASE:
EB4129
OU-MICROARRAY:
b0024
PORTECO:
yaaY
REGULONDB:
b0024
STRING:
511145.b0024
M3D: yaaY
COLOMBOS: yaaY
PortEco: b0024


Product      
Name: DUF2575 domain-containing protein YaaY
Synonym(s): YaaY
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.89
Isoelectric point: 9.984
Motif(s):
 
Type Positions Sequence
2 -> 72 CRHSLRSDGAGFYQLAGCEYSFSAIKIAAGGQFLPVICAMAMKSHFFLISVLNRRLTLTAVQGILGRFSLF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6087-MONOMER
ECOLIWIKI:
b0024
INTERPRO:
IPR020105
PFAM:
PF10837
PRIDE:
P75620
PRODOM:
PD056390
PROTEINMODELPORTAL:
P75620
REFSEQ:
NP_414565
UNIPROT:
P75620


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_46 20910 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_47 21020 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_48 21045 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_49 21094 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_50 21098 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_51 21112 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_53 21155 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_54 21157 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_55 21159 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_56 (cluster) 21208 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_58 (cluster) 21834 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_59 22220 forward nd [RS-EPT-CBR] [1]
  promoter TSS_60 22222 forward nd [RS-EPT-CBR] [1]
  promoter TSS_62 22244 forward nd [RS-EPT-CBR] [1]
  promoter TSS_63 22262 forward nd [RS-EPT-CBR] [1]
  promoter TSS_64 22279 forward nd [RS-EPT-CBR] [1]
  promoter TSS_65 (cluster) 22306 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB