RegulonDB RegulonDB 10.8: Gene Form
   

tilS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tilS yaeR rof yaeP TSS_392 TSS_392

Gene      
Name: tilS    Texpresso search in the literature
Synonym(s): ECK0187, G6096, b0188, mesJ, yaeN
Genome position(nucleotides): 212331 --> 213629 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.04
External database links:  
ASAP:
ABE-0000638
ECHOBASE:
EB3011
OU-MICROARRAY:
b0188
PortEco:
tilS
STRING:
511145.b0188
COLOMBOS: tilS


Product      
Name: tRNAIle-lysidine synthetase
Synonym(s): MesJ, TilS, YaeN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.204
Isoelectric point: 7.0
Motif(s):
 
Type Positions Sequence
14 -> 191 QILVAFSGGLDSTVLLHQLVQWRTENPGVALRAIHVHHGLSANADAWVTHCENVCQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFARTLLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELVQWARQYDLRWIEDESNQDDSYDRNFLR
20 -> 25 SGGLDS
356 -> 427 VSVRFKAPGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFYGETLIAAAGVFVTQEGVAEGENGVSFVW
241 -> 308 LQIVPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQEVALAREDASPCLRLGAFEIRRYQSQLW

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016874 - ligase activity
GO:0016879 - ligase activity, forming carbon-nitrogen bonds
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
GO:0032267 - tRNA(Ile)-lysidine synthase activity
biological_process GO:0006400 - tRNA modification
GO:0008033 - tRNA processing
GO:0002136 - tRNA wobble base lysidine biosynthesis
Note(s): Note(s): ...[more].
Reference(s): [1] Shapiro AB., et al., 2014
External database links:  
DIP:
DIP-10190N
ECOCYC:
G6096-MONOMER
ECOLIWIKI:
b0188
INTERPRO:
IPR015262
INTERPRO:
IPR012796
INTERPRO:
IPR012094
INTERPRO:
IPR012795
INTERPRO:
IPR014729
INTERPRO:
IPR011063
MINT:
MINT-1261006
MODBASE:
P52097
PANTHER:
PTHR43033:SF1
PDB:
1NI5
PFAM:
PF09179
PFAM:
PF01171
PFAM:
PF11734
PRIDE:
P52097
PRODB:
PRO_000024071
REFSEQ:
NP_414730
SMART:
SM00977
SMR:
P52097
UNIPROT:
P52097


Operon      
Name: tilS         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_392 212306 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Shapiro AB., Plant H., Walsh J., Sylvester M., Hu J., Gao N., Livchak S., Tentarelli S., Thresher J., 2014, Discovery of ATP-Competitive Inhibitors of tRNAIle Lysidine Synthetase (TilS) by High-Throughput Screening., J Biomol Screen 19(8):1137-1146

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB