RegulonDB RegulonDB 10.8: Gene Form
   

rof gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tilS yaeQ rof yaeP arfB CRP yaeQp yaeQp TSS_395 TSS_395 TSS_394 TSS_394 yaeQp6 yaeQp6 yaePp yaePp TSS_393 TSS_393 yaeQp3 yaeQp3

Gene      
Name: rof    Texpresso search in the literature
Synonym(s): ECK0188, G6097, b0189, yaeO
Genome position(nucleotides): 213678 <-- 213932 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.84
External database links:  
ASAP:
ABE-0000641
ECHOBASE:
EB3012
OU-MICROARRAY:
b0189
PortEco:
rof
STRING:
511145.b0189
COLOMBOS: rof


Product      
Name: modulator of Rho-dependent transcription termination
Synonym(s): Rof, YaeO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.48
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
7 -> 81 PINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDLVSRKNVEYLVVEAAGETRELRLDKITSFSHPEIGTVVV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0031554 - regulation of DNA-templated transcription, termination
GO:0031564 - transcription antitermination
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
[IMP] Inferred from mutant phenotype
Reference(s): [1] Gutierrez P., et al., 2007
[2] Kawamura N., et al., 2005
[3] Pichoff S., et al., 1998
External database links:  
ECOCYC:
G6097-MONOMER
ECOLIWIKI:
b0189
INTERPRO:
IPR023534
INTERPRO:
IPR038626
INTERPRO:
IPR009778
MINT:
P0AFW8
PDB:
1SG5
PFAM:
PF07073
PRIDE:
P0AFW8
PRODB:
PRO_000023804
REFSEQ:
NP_414731
SMR:
P0AFW8
SWISSMODEL:
P0AFW8
UNIPROT:
P0AFW8


Operon      
Name: yaeP-rof         
Operon arrangement:
Transcription unit        Promoter
yaeP-rof


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaeQp3 214088 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_393 214163 reverse nd [RS-EPT-CBR] [5]
  promoter yaeQp6 214195 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_394 214197 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_395 214269 forward nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gutierrez P., Kozlov G., Gabrielli L., Elias D., Osborne MJ., Gallouzi IE., Gehring K., 2007, Solution structure of YaeO, a Rho-specific inhibitor of transcription termination., J Biol Chem 282(32):23348-53

 [2] Kawamura N., Kurokawa K., Ito T., Hamamoto H., Koyama H., Kaito C., Sekimizu K., 2005, Participation of Rho-dependent transcription termination in oxidative stress sensitivity caused by an rpoB mutation., Genes Cells 10(5):477-87

 [3] Pichoff S., Alibaud L., Guedant A., Castanie MP., Bouche JP., 1998, An Escherichia coli gene (yaeO) suppresses temperature-sensitive mutations in essential genes by modulating Rho-dependent transcription termination., Mol Microbiol 29(3):859-69

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB