RegulonDB RegulonDB 10.8: Gene Form
   

yaeQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nlpE yaeQ arfB yaeP rof CRP TSS_396 TSS_396 yaeQp yaeQp TSS_395 TSS_395 TSS_394 TSS_394 yaeQp6 yaeQp6 yaePp yaePp TSS_393 TSS_393 yaeQp3 yaeQp3

Gene      
Name: yaeQ    Texpresso search in the literature
Synonym(s): ECK0190, G6098, b0190
Genome position(nucleotides): 214291 --> 214836 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.38
External database links:  
ASAP:
ABE-0000648
ECHOBASE:
EB3014
OU-MICROARRAY:
b0190
PortEco:
yaeQ
STRING:
511145.b0190
COLOMBOS: yaeQ


Product      
Name: uncharacterized protein YaeQ
Synonym(s): YaeQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 20.877
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
1 -> 173 MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLLAWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVALFTYNSRAAQIWWQQNQSKCVQFANLSVWYLDDEQLAKVSAFADRTMTLQATIQDGVIWLSDDKNNLEVN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6098-MONOMER
ECOLIWIKI:
b0190
INTERPRO:
IPR009822
INTERPRO:
IPR038590
INTERPRO:
IPR011335
PANTHER:
PTHR38784
PDB:
3C0U
PFAM:
PF07152
PRIDE:
P0AA97
REFSEQ:
NP_414732
SMART:
SM01322
SMR:
P0AA97
UNIPROT:
P0AA97


Operon      
Name: yaeQ-arfB-nlpE         
Operon arrangement:
Transcription unit        Promoter
yaeQ-arfB-nlpE


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaeQp3 214088 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_393 214163 reverse nd [RS-EPT-CBR] [2]
  promoter yaeQp6 214195 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_394 214197 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_395 214269 forward nd [RS-EPT-CBR] [2]
  promoter TSS_396 215265 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB