RegulonDB RegulonDB 10.8: Gene Form
   

gloB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mltD gloB yafS rnhA gloBp5 gloBp5 TSS_430 TSS_430 yafSp2 yafSp2 mltDp3 mltDp3 mltDp4 mltDp4 TSS_429 TSS_429

Gene      
Name: gloB    Texpresso search in the literature
Synonym(s): ECK0212, G6099, b0212, yafR
Genome position(nucleotides): 234027 <-- 234782 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.21
External database links:  
ASAP:
ABE-0000707
ECHOBASE:
EB3114
OU-MICROARRAY:
b0212
PortEco:
gloB
STRING:
511145.b0212
COLOMBOS: gloB


Product      
Name: hydroxyacylglutathione hydrolase GloB
Synonym(s): GloB, YafR, glyoxalase II
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.434
Isoelectric point: 5.537
Motif(s):
 
Type Positions Sequence
166 -> 251 EYTLSNMKFALSILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEERFAWLRSKKDRF
136 -> 138 RLF
245 -> 248 RSKK
12 -> 165 NYIWVLNDEAGRCLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQETQDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHICYFSKPYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAH
165 -> 167 HEY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.23 - methylglyoxal metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004416 - hydroxyacylglutathione hydrolase activity
GO:0008270 - zinc ion binding
biological_process GO:0009408 - response to heat
GO:0019243 - methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione
GO:0009636 - response to toxic substance
Note(s): Note(s): ...[more].
Reference(s): [1] McCarthy AJ., et al., 2016
External database links:  
DIP:
DIP-48248N
ECOCYC:
GLYOXII-MONOMER
ECOLIWIKI:
b0212
INTERPRO:
IPR036866
INTERPRO:
IPR035680
INTERPRO:
IPR017782
INTERPRO:
IPR001279
INTERPRO:
IPR032282
MINT:
MINT-1295781
MODBASE:
P0AC84
PANTHER:
PTHR11935:SF7
PFAM:
PF16123
PFAM:
PF00753
PRIDE:
P0AC84
REFSEQ:
NP_414748
SMART:
SM00849
SMR:
P0AC84
UNIPROT:
P0AC84


Operon      
Name: gloB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_429 233980 reverse nd [RS-EPT-CBR] [2]
  promoter mltDp4 233982 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter mltDp3 234025 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yafSp2 234784 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_430 234785 forward nd [RS-EPT-CBR] [2]
  promoter gloBp5 234926 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] McCarthy AJ., Negus D., Martin P., Pechincha C., Oswald E., Stabler RA., Taylor PW., 2016, Pathoadaptive Mutations of Escherichia coli K1 in Experimental Neonatal Systemic Infection., PLoS One 11(11):e0166793

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB