RegulonDB RegulonDB 10.8: Gene Form
   

yafT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yafT ykfM C0067 aspV yafTp6 yafTp6 yafTp5 yafTp5 yafTp4 yafTp4 TSS_435 TSS_435

Gene      
Name: yafT    Texpresso search in the literature
Synonym(s): ECK0217, G6101, b0217
Genome position(nucleotides): 237335 --> 238120 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.75
External database links:  
ASAP:
ABE-0000727
ECHOBASE:
EB3116
OU-MICROARRAY:
b0217
PortEco:
yafT
STRING:
511145.b0217
COLOMBOS: yafT


Product      
Name: lipoprotein YafT
Synonym(s): YafT
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 29.606
Isoelectric point: 6.071
Motif(s):
 
Type Positions Sequence
19 -> 261 CASESSIDEKKKKAQVTQSNINKNTPQQLTDKDLFGNETTLAVSEEDIQAALDGDEFRVPLNSPVILVQSGNRAPETIMQEEMRKYYTVSTFSGIPDRQKPLTCNKNKDKNENEDVASAENMNWMQALRFVAAKGHQKAIIVYQDMLQTGKYDSALKSTVWSDYKNDKLTDAISLRYLVRFTLVDVATGEWATWSPVNYEYKVLPPLPDKNEASTTDMTEQQIMQLKQKTYKAMVKDLVNRYQ
1 -> 18 MNSKKLCCICVLFSLLAG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6101-MONOMER
ECOLIWIKI:
b0217
PRIDE:
P77339
PROSITE:
PS51257
REFSEQ:
NP_414752
UNIPROT:
P77339


Operon      
Name: yafT         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_435 236931 forward nd [RS-EPT-CBR] [1]
  promoter yafTp4 237235 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yafTp5 237260 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yafTp6 237278 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB