RegulonDB RegulonDB 10.8: Gene Form
   

ivy gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadE yafV ivy TSS_436 (cluster) TSS_436 (cluster) ivyp5 ivyp5 ivyp4 ivyp4 yafVp yafVp

Gene      
Name: ivy    Texpresso search in the literature
Synonym(s): ECK0221, G6104, b0220, ykfE
Genome position(nucleotides): 240343 --> 240816 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0000740
ECHOBASE:
EB3317
OU-MICROARRAY:
b0220
PortEco:
ivy
STRING:
511145.b0220
COLOMBOS: ivy


Product      
Name: periplasmic chaperone, inhibitor of vertebrate C-type lysozyme
Synonym(s): Ivy, YkfE
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 16.872
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
39 -> 152 KGETTKAAFNQMVQGHKLPAWVMKGGTYTPAQTVTLGDETYQVMSACKPHDCGSQRIAVMWSEKSNQMTGLFSTIDEKTSQEKLTWLNVNDALSIDGKTVLFAALTGSLENHPD
1 -> 28 MGRISSGGMMFKAITTVAALVIATSAMA
29 -> 157 QDDLTISSLAKGETTKAAFNQMVQGHKLPAWVMKGGTYTPAQTVTLGDETYQVMSACKPHDCGSQRIAVMWSEKSNQMTGLFSTIDEKTSQEKLTWLNVNDALSIDGKTVLFAALTGSLENHPDGFNFK
36 -> 36 S

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0042803 - protein homodimerization activity
GO:0060241 - lysozyme inhibitor activity
biological_process GO:0050790 - regulation of catalytic activity
GO:0043086 - negative regulation of catalytic activity
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10051N
ECOCYC:
G6104-MONOMER
ECOLIWIKI:
b0220
INTERPRO:
IPR014453
INTERPRO:
IPR036501
MODBASE:
P0AD59
PDB:
1GPQ
PDB:
1XS0
PFAM:
PF08816
PRIDE:
P0AD59
PRODB:
PRO_000023041
REFSEQ:
NP_414755
SMR:
P0AD59
SWISSMODEL:
P0AD59
UNIPROT:
P0AD59


Operon      
Name: ivy         
Operon arrangement:
Transcription unit        Promoter
ivy


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ivyp4 240319 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ivyp5 240329 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_436 (cluster) 240333 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB