RegulonDB RegulonDB 10.8: Gene Form
   

fadE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadE gmhA ivy ArcA FadR TSS_442 TSS_442 TSS_441 TSS_441 TSS_440 (cluster) TSS_440 (cluster) TSS_439 TSS_439 TSS_438 TSS_438 TSS_437 TSS_437 lpcAp1 lpcAp1 fadEp fadEp

Gene      
Name: fadE    Texpresso search in the literature
Synonym(s): ECK0222, G6105, b0221, yafH
Genome position(nucleotides): 240859 <-- 243303 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.89
External database links:  
ASAP:
ABE-0000743
ECHOBASE:
EB2939
OU-MICROARRAY:
b0221
PortEco:
fadE
STRING:
511145.b0221
COLOMBOS: fadE


Product      
Name: acyl-CoA dehydrogenase
Synonym(s): FadE, YafH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 89.224
Isoelectric point: 8.214
Motif(s):
 
Type Positions Sequence
514 -> 792 IRCHPYVLEEMEAAKNNDVNAFDKLLFKHIGHVGSNKVRSFWLGLTRGLTSSTPTGDATKRYYQHLNRLSANLALLSDVSMAVLGGSLKRRERISARLGDILSQLYLASAVLKRYDDEGRNEADLPLVHWGVQDALYQAEQAMDDLLQNFPNRVVAGLLNVVIFPTGRHYLAPSDKLDHKVAKILQVPNATRSRIGRGQYLTPSEHNPVGLLEEALVDVIAADPIHQRICKELGKNLPFTRLDELAHNALVKGLIDKDEAAILVKAEESRLRSINVDDF
147 -> 232 ELADLPPELWAYLKEHRFFAMIIKKEYGGLEFSAYAQSRVLQKLSGVSGILAITVGVPNSLGPGELLQHYGTDEQKDHYLPRLARG
360 -> 504 GQGWRMLVECLSVGRGITLPSNSTGGVKSVALATGAYAHIRRQFKISIGKMEGIEEPLARIAGNAYVMDAAASLITYGIMLGEKPAVLSAIVKYHCTHRGQQSIIDAMDITGGKGIMLGQSNFLARAYQGAPIAITVEGANILTR
237 -> 328 CFALTSPEAGSDAGAIPDTGIVCMGEWQGQQVLGMRLTWNKRYITLAPIATVLGLAFKLSDPEKLLGGAEDLGITCALIPTTTPGVEIGRRH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005886 - plasma membrane
molecular_function GO:0004466 - long-chain-acyl-CoA dehydrogenase activity
GO:0016491 - oxidoreductase activity
GO:0016627 - oxidoreductase activity, acting on the CH-CH group of donors
GO:0050660 - flavin adenine dinucleotide binding
GO:0003995 - acyl-CoA dehydrogenase activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0009062 - fatty acid catabolic process
GO:0006635 - fatty acid beta-oxidation
GO:0055114 - oxidation-reduction process
GO:0033539 - fatty acid beta-oxidation using acyl-CoA dehydrogenase
Note(s): Note(s): ...[more].
Reference(s): [1] Clomburg JM., et al., 2012
[2] Cronan JE., et al., 1975
[3] Gulevich AY., et al., 2016
[4] Harley JB., et al., 1978
[5] Iram SH., et al., 2006
[6] Lau C., et al., 1983
[7] Lu X., et al., 2003
[8] Olsen WL., et al., 1979
External database links:  
ECOCYC:
ACYLCOADEHYDROG-MONOMER
ECOLIWIKI:
b0221
INTERPRO:
IPR036250
INTERPRO:
IPR037069
INTERPRO:
IPR015396
INTERPRO:
IPR013786
INTERPRO:
IPR009100
INTERPRO:
IPR009075
INTERPRO:
IPR006091
MODBASE:
Q47146
PFAM:
PF02770
PFAM:
PF02771
PFAM:
PF09317
PFAM:
PF00441
PRIDE:
Q47146
PRODB:
PRO_000022569
PROSITE:
PS00072
PROSITE:
PS00073
REFSEQ:
NP_414756
SMR:
Q47146
UNIPROT:
Q47146


Operon      
Name: fadE         
Operon arrangement:
Transcription unit        Promoter
fadE


Transcriptional Regulation      
Display Regulation             
Repressed by: FadR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter lpcAp1 243468 forward Similarity to the consensus
Read more >
[ICWHO] [9]
  promoter TSS_437 243512 forward nd [RS-EPT-CBR] [10]
  promoter TSS_438 244083 forward nd [RS-EPT-CBR] [10]
  promoter TSS_439 244089 forward nd [RS-EPT-CBR] [10]
  promoter TSS_440 (cluster) 244094 forward For this promoter, there
Read more >
[RS-EPT-CBR] [10]
  promoter TSS_441 244103 forward nd [RS-EPT-CBR] [10]
  promoter TSS_442 244121 forward nd [RS-EPT-CBR] [10]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Clomburg JM., Vick JE., Blankschien MD., Rodriguez-Moya M., Gonzalez R., 2012, A synthetic biology approach to engineer a functional reversal of the β-oxidation cycle., ACS Synth Biol 1(11):541-54

 [2] Cronan JE., Weisberg LJ., Allen RG., 1975, Regulation of membrane lipid synthesis in Escherichia coli. Accumulation of free fatty acids of abnormal length during inhibition of phospholipid synthesis., J Biol Chem 250(15):5835-40

 [3] Gulevich AY., Skorokhodova AY., Debabov VG., 2016, [Escherichia coli ydiO and ydiQRST genes encode components of acyl-CoA dehydrogenase complex of anaerobic fatty acid β-oxidation pathway]., Genetika 52(10):1210-4

 [4] Harley JB., Santangelo GM., Rasmussen H., Goldfine H., 1978, Dependence of Escherichia coli hyperbaric oxygen toxicity on the lipid acyl chain composition., J Bacteriol 134(3):808-20

 [5] Iram SH., Cronan JE., 2006, The beta-oxidation systems of Escherichia coli and Salmonella enterica are not functionally equivalent., J Bacteriol 188(2):599-608

 [6] Lau C., Greenway DL., Freter CE., Neungton N., Wattenberg B., Silbert DF., 1983, Conditions influencing formation of 16:0/16:0 molecular species in membrane phospholipids of Escherichia coli., J Biol Chem 258(21):13027-33

 [7] Lu X., Zhang J., Wu Q., Chen GQ., 2003, Enhanced production of poly(3-hydroxybutyrate-co-3-hydroxyhexanoate) via manipulating the fatty acid beta-oxidation pathway in E. coli., FEMS Microbiol Lett 221(1):97-101

 [8] Olsen WL., Schaechter M., Khorana HG., 1979, Incorporation of synthetic fatty acid analogs into phospholipids of Escherichia coli., J Bacteriol 137(3):1443-6

 [9] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [10] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB