RegulonDB RegulonDB 10.8: Gene Form
   

yafO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yafP yafO yafN

Gene      
Name: yafO    Texpresso search in the literature
Synonym(s): ECK0234, G6117, b0233
Genome position(nucleotides): 252301 --> 252699 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.61
External database links:  
ASAP:
ABE-0000795
ECHOBASE:
EB2946
OU-MICROARRAY:
b0233
PortEco:
yafO
STRING:
511145.b0233
COLOMBOS: yafO


Product      
Name: ribosome-dependent mRNA interferase toxin YafO
Synonym(s): YafO, ribosome-dependent mRNA interferase, toxin of the YafO-YafN toxin-antitoxin system
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.488
Isoelectric point: 7.732
Motif(s):
 
Type Positions Sequence
27 -> 130 SYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRTNDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRM

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.1 - translation attenuation and efficiency
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0016787 - hydrolase activity
GO:0003723 - RNA binding
GO:0004521 - endoribonuclease activity
GO:0043023 - ribosomal large subunit binding
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0017148 - negative regulation of translation
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0090502 - RNA phosphodiester bond hydrolysis, endonucleolytic
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IMP] Inferred from mutant phenotype
Reference(s): [1] Brown JM., et al., 2003
[2] Zhang Y., et al., 2009
External database links:  
ECOCYC:
G6117-MONOMER
ECOLIWIKI:
b0233
INTERPRO:
IPR020353
PFAM:
PF13957
PRIDE:
Q47157
PRODOM:
PD082093
REFSEQ:
NP_414768
UNIPROT:
Q47157


Operon      
Name: dinB-yafNOP         
Operon arrangement:
Transcription unit        Promoter
dinB-yafNOP
yafNOP


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Brown JM., Shaw KJ., 2003, A novel family of Escherichia coli toxin-antitoxin gene pairs., J Bacteriol 185(22):6600-8

 [2] Zhang Y., Yamaguchi Y., Inouye M., 2009, Characterization of YafO, an Escherichia coli Toxin., J Biol Chem 284(38):25522-31


RegulonDB