RegulonDB RegulonDB 10.8: Gene Form
   

ykfI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ykfI yafW thrW ykfN ykfIp7 ykfIp7

Gene      
Name: ykfI    Texpresso search in the literature
Synonym(s): ECK0246, G6120, b0245
Genome position(nucleotides): 263328 <-- 263669 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.17
External database links:  
ASAP:
ABE-0000836
ECHOBASE:
EB4079
ECOO157CYC:
Z3165
OU-MICROARRAY:
b0245
PortEco:
ykfI
STRING:
511145.b0245
COLOMBOS: ykfI


Product      
Name: CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system
Synonym(s): YkfI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.905
Isoelectric point: 9.677
Motif(s):
 
Type Positions Sequence
1 -> 112 MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGFSWQEQSPYLRAADILRARQATGLLRQSRNNVV
65 -> 65 F

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0030308 - negative regulation of cell growth
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Brown JM., et al., 2003
External database links:  
ECOCYC:
G6120-MONOMER
ECOLIWIKI:
b0245
ECOO157CYC:
Z3165-MONOMER
INTERPRO:
IPR009610
PFAM:
PF06755
PRIDE:
P77692
REFSEQ:
NP_414779
UNIPROT:
P77692


Operon      
Name: yafY-ykfBF-yafX-ykfGH-yafW-ykfI         
Operon arrangement:
Transcription unit        Promoter
ykfBF-yafX-ykfGH-yafW-ykfI
ykfBF-yafX-ykfGH-yafW-ykfI
ykfGH-yafW-ykfI
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ykfIp7 263818 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Brown JM., Shaw KJ., 2003, A novel family of Escherichia coli toxin-antitoxin gene pairs., J Bacteriol 185(22):6600-8

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB