RegulonDB RegulonDB 10.8: Gene Form
   

yafX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yafX    Texpresso search in the literature
Synonym(s): ECK0250, G6123, b0248
Genome position(nucleotides): 264748 <-- 265206 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
External database links:  
ASAP:
ABE-0000843
ECHOBASE:
EB3120
OU-MICROARRAY:
b0248
PortEco:
yafX
STRING:
511145.b0248
COLOMBOS: yafX


Product      
Name: CP4-6 prophage; protein YafX
Synonym(s): YafX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.42
Isoelectric point: 4.393
Motif(s):
 
Type Positions Sequence
60 -> 152 GYSGGIWSFYTLSNGGAFMSPEPDNDETWRLFNCLNGNDAQMSAEAAGIAVCLIAYSHHACRTECDAMTAHYYRLREYAMQHPEAHAILRIID

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6123-MONOMER
ECOLIWIKI:
b0248
INTERPRO:
IPR042297
INTERPRO:
IPR004914
PFAM:
PF03230
PRIDE:
P75676
PRODOM:
PD012854
REFSEQ:
NP_414782
SMR:
P75676
UNIPROT:
P75676


Operon      
Name: yafY-ykfBF-yafX-ykfGH-yafW-ykfI         
Operon arrangement:
Transcription unit        Promoter
ykfBF-yafX-ykfGH-yafW-ykfI
ykfBF-yafX-ykfGH-yafW-ykfI
ykfGH-yafW-ykfI
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB