RegulonDB RegulonDB 10.8: Gene Form
   

ykfF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ykfB yafX ykfF anti-terminator terminator terminator

Gene      
Name: ykfF    Texpresso search in the literature
Synonym(s): ECK0251, G6124, b0249
Genome position(nucleotides): 265304 <-- 265543 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.75
External database links:  
ASAP:
ABE-0000846
ECHOBASE:
EB4031
OU-MICROARRAY:
b0249
PortEco:
ykfF
STRING:
511145.b0249
COLOMBOS: ykfF


Product      
Name: CP4-6 prophage; protein YkfF
Synonym(s): YkfF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 9.014
Isoelectric point: 9.165
Motif(s):
 
Type Positions Sequence
6 -> 74 LLPPGPFTRRQAQAVTTTYSNITLEDDQGSHFRLVVRDTEGRMVWRAWNFEPDAGEGLNRYIRTSGIRT

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6124-MONOMER
ECOLIWIKI:
b0249
INTERPRO:
IPR009253
INTERPRO:
IPR038612
PDB:
2HJJ
PFAM:
PF06006
PRIDE:
P75677
PRODOM:
PD028015
REFSEQ:
NP_414783
SMR:
P75677
UNIPROT:
P75677


Operon      
Name: yafY-ykfBF-yafX-ykfGH-yafW-ykfI         
Operon arrangement:
Transcription unit        Promoter
ykfBF-yafX-ykfGH-yafW-ykfI
ykfBF-yafX-ykfGH-yafW-ykfI
ykfGH-yafW-ykfI
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB