RegulonDB RegulonDB 10.8: Gene Form
   

ykfB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ykfB yafY ykfF anti-terminator terminator ykfBp2 ykfBp2 ykfBp1 ykfBp1

Gene      
Name: ykfB    Texpresso search in the literature
Synonym(s): ECK0252, G6125, b0250
Genome position(nucleotides): 265620 <-- 266087 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.56
External database links:  
ASAP:
ABE-0000851
ECHOBASE:
EB3318
OU-MICROARRAY:
b0250
PortEco:
ykfB
STRING:
511145.b0250
COLOMBOS: ykfB


Product      
Name: CP4-6 prophage; protein YkfB
Synonym(s): YkfB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 17.026
Isoelectric point: 4.266
Motif(s):
 
Type Positions Sequence
1 -> 23 MTILSLSRFMLAGVLLASFNASA
24 -> 155 IPGFWQQGYGQGNTEYSVTEASGKTFTINCTGNPDQNGFYQHSVFLTLADDKMVSSHDDDTTITVVMDHQQYIIPSSLGWRNGDNAWFDFISNISEAGQFDVYVNDHKAGTFTADRKNAEKVLSTLGDCSND

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6125-MONOMER
ECOLIWIKI:
b0250
PRIDE:
P77162
REFSEQ:
NP_414784
UNIPROT:
P77162


Operon      
Name: yafY-ykfBF-yafX-ykfGH-yafW-ykfI         
Operon arrangement:
Transcription unit        Promoter
ykfBF-yafX-ykfGH-yafW-ykfI
ykfBF-yafX-ykfGH-yafW-ykfI
ykfGH-yafW-ykfI
 


Regulation by small RNA    
  Display Regulation
small RNA omrA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB