RegulonDB RegulonDB 10.8: Gene Form
   

yafZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yafZ    Texpresso search in the literature
Synonym(s): ECK0254, G6127, b0252
Genome position(nucleotides): 267184 <-- 268005 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.79
External database links:  
ASAP:
ABE-0000856
ECHOBASE:
EB3122
OU-MICROARRAY:
b0252
PortEco:
yafZ
STRING:
511145.b0252
COLOMBOS: yafZ


Product      
Name: CP4-6 prophage; DUF932 domain-containing protein YafZ
Synonym(s): YafZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.051
Isoelectric point: 9.663
Motif(s):
 
Type Positions Sequence
37 -> 262 KHESRSERYTYIPTISLLDSLQREGFQPFFACQTRVRDPGRREHTKHMLRLRREGQITGKQVPEIILLNSHDGTSSYQMLPGLFRAVCQNGLVCGESFGEVRVPHKGDVVSQVIEGAYEVLGIFDRVEEKRDAMQSLLLPPPAQQALAKAALTYRFGEDHQPVTESQILSPRRWQDESNDLWTTYQRIQENLIKGGLSGRNAKGGRSHTRAVRGIDGDVKLNRALW

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11229N
ECOCYC:
G6127-MONOMER
ECOLIWIKI:
b0252
INTERPRO:
IPR026325
PFAM:
PF06067
PRIDE:
P77206
REFSEQ:
NP_414786
UNIPROT:
P77206


Operon      
Name: ykfA-yafZ         
Operon arrangement:
Transcription unit        Promoter
yafZ
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB