RegulonDB RegulonDB 10.8: Gene Form
   

ykfA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

perR ykfA yafZ anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator yafZp yafZp

Gene      
Name: ykfA    Texpresso search in the literature
Synonym(s): ECK0255, G6128, b0253
Genome position(nucleotides): 268097 <-- 268960 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.83
External database links:  
ASAP:
ABE-0000858
ECHOBASE:
EB3123
ECOO157CYC:
Z1650
OU-MICROARRAY:
b0253
PortEco:
ykfA
STRING:
511145.b0253
COLOMBOS: ykfA


Product      
Name: CP4-6 prophage; putative GTP-binding protein YkfA
Synonym(s): YkfA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.892
Isoelectric point: 7.907
Motif(s):
 
Type Positions Sequence
90 -> 93 DLPG
39 -> 134 IGIMGKTGVGKSSLCNALFAGDISPVSDVAACTREPLRFRLQVGDRYITLMDLPGVGESGARDTEYAALYREQLPRLDLVLWLIKADDRALTVDEH
48 -> 138 GKSSLCNALFAGDISPVSDVAACTREPLRFRLQVGDRYITLMDLPGVGESGARDTEYAALYREQLPRLDLVLWLIKADDRALTVDEHFYHQ
156 -> 159 DKAE
43 -> 50 GKTGVGKS

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
biological_process GO:0030488 - tRNA methylation
GO:0002098 - tRNA wobble uridine modification
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6128-MONOMER
ECOLIWIKI:
b0253
ECOO157CYC:
Z1650-MONOMER
INTERPRO:
IPR006073
INTERPRO:
IPR027417
MODBASE:
P75678
PFAM:
PF01926
PRIDE:
P75678
REFSEQ:
NP_414787
SMR:
P75678
UNIPROT:
P75678


Operon      
Name: ykfA-yafZ         
Operon arrangement:
Transcription unit        Promoter
yafZ
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB