RegulonDB RegulonDB 10.8: Gene Form
   

insB2 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insAB2 insB2 afuB insA2 insI2 TSS_469 TSS_469 TSS_468 TSS_468 TSS_467 (cluster) TSS_467 (cluster)

Gene      
Name: insB2    Texpresso search in the literature
Synonym(s): ECK0022, G6138, b0264
Genome position(nucleotides): 279178 <-- 279681 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.16
External database links:  
ASAP:
ABE-0000906
ECOO157CYC:
Z1632
ECOO157CYC:
Z1562
ECOO157CYC:
Z5491
ECOO157CYC:
Z1123
ECOO157CYC:
Z1192
OU-MICROARRAY:
b0264
PortEco:
insB-2
STRING:
511145.b0274
COLOMBOS: insB2


Product      
Name: IS1 protein InsB
Synonym(s): InsB2
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.758
Isoelectric point: 10.847
Motif(s):
 
Type Positions Sequence
37 -> 167 VIVCAEMDEQWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVEQHDKVIGHYLNIKHYQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Escoubas JM., et al., 1994
External database links:  
ECOCYC:
G6138-MONOMER
ECOLIWIKI:
b0264
ECOO157CYC:
Z5491-MONOMER
ECOO157CYC:
Z1632-MONOMER
ECOO157CYC:
Z1562-MONOMER
ECOO157CYC:
Z1192-MONOMER
ECOO157CYC:
Z1123-MONOMER
INTERPRO:
IPR005063
PFAM:
PF03400
PRIDE:
P0CF26
PRODB:
PRO_000023016
REFSEQ:
NP_414798
UNIPROT:
P0CF26


Operon      
Name: insAB2A2B2-afuBC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_467 (cluster) 279709 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_468 279891 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_469 279893 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Escoubas JM., Lane D., Chandler M., 1994, Is the IS1 transposase, InsAB', the only IS1-encoded protein required for efficient transposition?, J Bacteriol 176(18):5864-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB