RegulonDB RegulonDB 10.8: Gene Form
   

insA2 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insAB2 insB2 yagB insA2 insX insI2 TSS_469 TSS_469 TSS_468 TSS_468 TSS_467 (cluster) TSS_467 (cluster)

Gene      
Name: insA2    Texpresso search in the literature
Synonym(s): ECK0023, G6139, b0265
Genome position(nucleotides): 279600 <-- 279875 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.26
External database links:  
ASAP:
ABE-0000909
OU-MICROARRAY:
b0265
PortEco:
insA-2
STRING:
511145.b4516
COLOMBOS: insA2


Product      
Name: IS1 protein InsA
Synonym(s): InsA2
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 9.902
Isoelectric point: 10.862
Motif(s):
 
Type Positions Sequence
43 -> 88 FTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTIFRHLKNSG
1 -> 36 MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCR

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Escoubas JM., et al., 1994
External database links:  
ECOCYC:
G6139-MONOMER
ECOLIWIKI:
b0265
INTERPRO:
IPR024431
INTERPRO:
IPR003220
PFAM:
PF03811
PFAM:
PF12759
PRIDE:
P0CF08
REFSEQ:
NP_414799
SMR:
P0CF08
UNIPROT:
P0CF08


Operon      
Name: insAB2A2B2-afuBC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_467 (cluster) 279709 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_468 279891 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_469 279893 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Escoubas JM., Lane D., Chandler M., 1994, Is the IS1 transposase, InsAB', the only IS1-encoded protein required for efficient transposition?, J Bacteriol 176(18):5864-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB