RegulonDB RegulonDB 10.8: Gene Form
   

yagF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yagF yagG yagE terminator anti-terminator anti-anti-terminator yagGp8 yagGp8 yagGp7 yagGp7 yagGp6 yagGp6 yagGp9 yagGp9

Gene      
Name: yagF    Texpresso search in the literature
Synonym(s): ECK0270, G6141, b0269
Genome position(nucleotides): 283201 --> 285168 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
66.72
External database links:  
ASAP:
ABE-0000923
ECHOBASE:
EB3129
OU-MICROARRAY:
b0269
PortEco:
yagF
STRING:
511145.b0269
COLOMBOS: yagF


Product      
Name: CP4-6 prophage; D-xylonate dehydratase
Synonym(s): YagF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 69.399
Isoelectric point: 6.389
Motif(s):
 
Type Positions Sequence
86 -> 604 HTGHWEIGMQMQAAAKEITRNGGIPFAAFVSDPCDGRSQGTHGMFDSLPYRNDAAIVFRRLIRSLPTRRAVIGVATCDKGLPATMIALAAMHDLPTILVPGGATLPPTVGEDAGKVQTIGARFANHELSLQEAAELGCRACASPGGGCQFLGTAGTSQVVAEALGLALPHSALAPSGQAVWLEIARQSARAVSELDSRGITTRDILSDKAIENAMVIHAAFGGSTNLLLHIPAIAHAAGCTIPDVEHWTRINRKVPRLVSVLPNGPDYHPTVRAFLAGGVPEVMLHLRDLGLLHLDAMTVTGQTVGENLEWWQASERRARFRQCLREQDGVEPDDVILPPEKAKAKGLTSTVCFPTGNIAPEGSVIKATAIDPSVVGEDGVYHHTGRVRVFVSEAQAIKAIKREEIVQGDIMVVIGGGPSGTGMEETYQLTSALKHISWGKTVSLITDARFSGVSTGACFGHVSPEALAGGPIGKLRDNDIIEIAVDRLTLTGSVNFIGTADNPLTPEEGARELARRQT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0016836 - hydro-lyase activity
GO:0050401 - xylonate dehydratase activity
biological_process GO:0046176 - aldonic acid catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Cabulong RB., et al., 2018
External database links:  
ECOCYC:
G6141-MONOMER
ECOLIWIKI:
b0269
INTERPRO:
IPR020558
INTERPRO:
IPR042096
INTERPRO:
IPR037237
INTERPRO:
IPR017798
INTERPRO:
IPR000581
PANTHER:
PTHR21000
PFAM:
PF00920
PRIDE:
P77596
PROSITE:
PS00887
PROSITE:
PS00886
REFSEQ:
NP_414803
SMR:
P77596
UNIPROT:
P77596


Operon      
Name: yagEF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yagGp9 285207 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yagGp6 285271 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yagGp7 285350 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yagGp8 285353 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Cabulong RB., Lee WK., Banares AB., Ramos KRM., Nisola GM., Valdehuesa KNG., Chung WJ., 2018, Engineering Escherichia coli for glycolic acid production from D-xylose through the Dahms pathway and glyoxylate bypass., Appl Microbiol Biotechnol 102(5):2179-2189

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB