RegulonDB RegulonDB 10.8: Gene Form
   

yagH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yagH yagG xynR

Gene      
Name: yagH    Texpresso search in the literature
Synonym(s): ECK0272, G6143, b0271
Genome position(nucleotides): 286789 --> 288399 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
64.37
External database links:  
ASAP:
ABE-0000931
ECHOBASE:
EB3131
OU-MICROARRAY:
b0271
PortEco:
yagH
STRING:
511145.b0271
COLOMBOS: yagH


Product      
Name: CP4-6 prophage; putative xylosidase/arabinosidase
Synonym(s): YagH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 60.825
Isoelectric point: 5.512
Motif(s):
 
Type Positions Sequence
3 -> 303 ITNPILTGFNPDPSLCRQGEDYYIATSTFEWFPGVRIYHSRDLKNWSLVSTPLDRVSMLDMKGNPDSGGIWAPCLSYADGKFWLLYTDVKIVDSPWKNGRNFLVTAPSIEGPWSEPIPMGNGGFDPSLFHDDDGRKYYIYRPWGPRHHSNPHNTIVLQAFDPQTGTLSPERKTLFTGTPLCYTEGAHLYRHAGWYYLMAAEGGTSYEHAVVVLRSKNIDGPYELHPDVTMMTSWHLPENPLQKSGHGSLLQTHTGEWYMAYLTSRPLRLPGVPLLASGGRGYCPLGRETGIARIEWRDGWP
332 -> 534 RDDFDASSLDPELQTLRIPFDDTLGSLTARPGFLRLYGNDSLNSTFTQSTVARRWQHFAFRAETRMEFSPVHFQQSAGLTCYYNSKNWSYCFVDYEEGQGRTIKVIQLDHNVPSWPLHEQPIPVPEHAESVWLRVDVDTLVYRYSYSFDGETWHTVPVTYEAWKLSDDYIGGRGFFTGAFVGLHCEDISGDGCYADFDYFTYE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0009044 - xylan 1,4-beta-xylosidase activity
biological_process GO:0008152 - metabolic process
GO:0000272 - polysaccharide catabolic process
GO:0005975 - carbohydrate metabolic process
GO:0045493 - xylan catabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH43
ECOCYC:
G6143-MONOMER
ECOLIWIKI:
b0271
INTERPRO:
IPR023296
INTERPRO:
IPR013320
INTERPRO:
IPR006710
INTERPRO:
IPR041542
MODBASE:
P77713
PANTHER:
PTHR22925
PFAM:
PF04616
PFAM:
PF17851
PRIDE:
P77713
REFSEQ:
NP_414805
SMR:
P77713
SWISSMODEL:
P77713
UNIPROT:
P77713


Operon      
Name: yagGH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB