RegulonDB RegulonDB 10.7: Gene Form
   

yagL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yagM yagL yagK RcdA terminator yagLp7 yagLp7 yagKp6 yagKp6 TSS_473 TSS_473

Gene      
Name: yagL    Texpresso search in the literature
Synonym(s): ECK0277, G6149, b0278
Genome position(nucleotides): 293220 <-- 293918 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
37.34
External database links:  
ASAP:
ABE-0000970
ECHOBASE:
EB3321
OU-MICROARRAY:
b0278
PORTECO:
yagL
REGULONDB:
b0278
STRING:
511145.b0278
M3D: yagL
COLOMBOS: yagL
PortEco: b0278


Product      
Name: CP4-6 prophage; resolvase-like catalytic domain-containing protein YagL
Synonym(s): YagL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.274
Isoelectric point: 9.765
Motif(s):
 
Type Positions Sequence
185 -> 227 KLGRKEGSKYRRDITILKKGGFTQAEIAKKLSISLSTVKRHWN

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0000150 - recombinase activity
biological_process GO:0006310 - DNA recombination
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6149-MONOMER
ECOLIWIKI:
b0278
INTERPRO:
IPR011517
INTERPRO:
IPR036162
INTERPRO:
IPR036388
MODBASE:
P77607
PFAM:
PF07638
PRIDE:
P77607
PROTEINMODELPORTAL:
P77607
REFSEQ:
NP_414812
SMR:
P77607
UNIPROT:
P77607


Operon      
Name: yagML         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_473 293051 forward nd [RS-EPT-CBR] [1]
  promoter yagLp7 294031 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB