RegulonDB RegulonDB 10.7: Gene Form
   

yagP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paoC paoD yagP nc1 paoB

Gene      
Name: yagP    Texpresso search in the literature
Synonym(s): ECK0281, G6153, b0282, b4695, ykgT
Genome position(nucleotides): 297381 <-- 297791 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.55
External database links:  
ASAP:
ABE-0000982
ECHOBASE:
EB3325
ECOO157CYC:
Z0342
ECOO157CYC:
Z0346
OU-MICROARRAY:
b0282
PORTECO:
yagP
REGULONDB:
b0282
STRING:
316407.85674426
M3D: yagP
COLOMBOS: yagP
PortEco: b0282


Product      
Name: putative LysR family substrate binding domain-containing protein YagP
Synonym(s): YagP, YkgT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.411
Isoelectric point: 8.697
Motif(s):
 
Type Positions Sequence
25 -> 131 HKCIGWRQSPEVAPYRWPFEENGRTFDLAIEPQITTNDLRLMLRLALAGGGITIATQETFRPYIESGKLVSLLDDFLPQFPGFYLYFPQRRNIAPKLRALIDYVKEW

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6153-MONOMER
ECOLIWIKI:
b0282
ECOO157CYC:
Z0346-MONOMER
ECOO157CYC:
Z0342-MONOMER
INTERPRO:
IPR005119
MODBASE:
P75684
PFAM:
PF03466
PRIDE:
P75684
PROTEINMODELPORTAL:
P75684
REFSEQ:
NP_414816
SMR:
P75684
UNIPROT:
P75684


Operon      
Name: yagP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB