RegulonDB RegulonDB 10.7: Gene Form
   

paoD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paoC paoD yagP nc1 paoB

Gene      
Name: paoD    Texpresso search in the literature
Synonym(s): ECK0282, G6154, b0283, yagQ
Genome position(nucleotides): 297770 <-- 298726 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
59.98
External database links:  
ASAP:
ABE-0000984
ECHOBASE:
EB3326
OU-MICROARRAY:
b0283
PORTECO:
yagQ
REGULONDB:
b0283
STRING:
511145.b0283
M3D: paoD
COLOMBOS: paoD
PortEco: b0283


Product      
Name: molybdenum cofactor insertion chaperone PaoD
Synonym(s): PaoD, YagQ, molybdenum cofactor insertion chaperone for PaoABC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.954
Isoelectric point: 6.839
Motif(s):
 
Type Positions Sequence
180 -> 301 LMIYGRSLEAQATASLAAATGYDSHIFDLFPASASAQIDTDTAVILLCHDLNRELPVLQAAREAKPFYLGALGSYRTHTLRLQKLHELGWSREETTQIRAPVGIFPKARDAHTLALSVLAEV
36 -> 101 MSGKGAVLVTLVEIRGGAARPLGAQMVVREDGRYCGFVSGGCVEAAAAFEALEMMGSGRDREIRYG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0042803 - protein homodimerization activity
GO:0043546 - molybdopterin cofactor binding
External database links:  
ECOCYC:
G6154-MONOMER
ECOLIWIKI:
b0283
INTERPRO:
IPR003777
INTERPRO:
IPR027051
PFAM:
PF13478
PFAM:
PF02625
PRIDE:
P77183
PROTEINMODELPORTAL:
P77183
REFSEQ:
NP_414817
SMR:
P77183
UNIPROT:
P77183


Operon      
Name: paoABCD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB