RegulonDB RegulonDB 10.7: Gene Form
   

paoC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paoC paoD paoB paoA yagP terminator

Gene      
Name: paoC    Texpresso search in the literature
Synonym(s): ECK0283, G6155, b0284, yagR
Genome position(nucleotides): 298736 <-- 300934 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
59.44
External database links:  
ASAP:
ABE-0000988
ECHOBASE:
EB3327
OU-MICROARRAY:
b0284
PORTECO:
yagR
REGULONDB:
b0284
STRING:
511145.b0284
M3D: paoC
COLOMBOS: paoC
PortEco: b0284


Product      
Name: aldehyde dehydrogenase: molybdenum cofactor-binding subunit
Synonym(s): PaoC, YagR
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 78.088
Isoelectric point: 6.211
Motif(s):
 
Type Positions Sequence
440 -> 440 R
468 -> 470 IGT
161 -> 668 NVGDFDGAFTSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAKTLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTHRPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLATLDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQVDPADPTRCFSRRQLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEQNGTVTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTSGVYAACMKLREMIASAVGFDPEQSQFADGKITNGTRSATLHEATAGGRLTAEESIEFGTLSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMGAALMEELAVDDRLGYFVNHDMAGYEVPVHADIP
615 -> 621 RILNPKT
688 -> 691 KGVG

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0047770 - carboxylate reductase activity
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016903 - oxidoreductase activity, acting on the aldehyde or oxo group of donors
GO:0030151 - molybdenum ion binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6155-MONOMER
ECOLIWIKI:
b0284
INTERPRO:
IPR008274
INTERPRO:
IPR037165
INTERPRO:
IPR036856
INTERPRO:
IPR000674
MODBASE:
P77489
PDB:
5G5G
PDB:
5G5H
PFAM:
PF01315
PFAM:
PF02738
PRIDE:
P77489
PROTEINMODELPORTAL:
P77489
REFSEQ:
NP_414818
SMART:
SM01008
SMR:
P77489
UNIPROT:
P77489


Operon      
Name: paoABCD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB