RegulonDB RegulonDB 10.7: Gene Form
   

paoB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paoC paoD paoB paoA yagU yagP terminator TSS_476 TSS_476 TSS_475 (cluster) TSS_475 (cluster)

Gene      
Name: paoB    Texpresso search in the literature
Synonym(s): ECK0284, G6156, b0285, yagS
Genome position(nucleotides): 300931 <-- 301887 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
60.71
External database links:  
ASAP:
ABE-0000990
ECHOBASE:
EB3328
OU-MICROARRAY:
b0285
PORTECO:
yagS
REGULONDB:
b0285
STRING:
511145.b0285
M3D: paoB
COLOMBOS: paoB
PortEco: b0285


Product      
Name: aldehyde dehydrogenase, FAD-binding subunit
Synonym(s): PaoB, YagS
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 33.858
Isoelectric point: 9.121
Motif(s):
 
Type Positions Sequence
26 -> 34 KFIAGGTNL
1 -> 223 MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETPTHLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLAAHERVRRDYAVLSRALLAGASGQLRNQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPSDMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPLG
227 -> 300 IYRKVRDRASYAFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQAVYDTLFASAHPTAENTFKL
3 -> 220 AFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETPTHLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLAAHERVRRDYAVLSRALLAGASGQLRNQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPSDMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPP

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0047770 - carboxylate reductase activity
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0016903 - oxidoreductase activity, acting on the aldehyde or oxo group of donors
GO:0071949 - FAD binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6156-MONOMER
ECOLIWIKI:
b0285
INTERPRO:
IPR036683
INTERPRO:
IPR002346
INTERPRO:
IPR036318
INTERPRO:
IPR005107
INTERPRO:
IPR016166
INTERPRO:
IPR016169
MODBASE:
P77324
PDB:
5G5H
PDB:
5G5G
PFAM:
PF00941
PFAM:
PF03450
PRIDE:
P77324
PROSITE:
PS51387
PROTEINMODELPORTAL:
P77324
REFSEQ:
NP_414819
SMART:
SM01092
SMR:
P77324
UNIPROT:
P77324


Operon      
Name: paoABCD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_475 (cluster) 302957 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_476 302974 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB