RegulonDB RegulonDB 10.7: Gene Form
   

paoA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paoC paoB paoA yagU terminator TSS_476 TSS_476 TSS_475 (cluster) TSS_475 (cluster)

Gene      
Name: paoA    Texpresso search in the literature
Synonym(s): ECK0285, G6157, b0286, yagT
Genome position(nucleotides): 301884 <-- 302573 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.78
External database links:  
ASAP:
ABE-0000992
ECHOBASE:
EB3329
OU-MICROARRAY:
b0286
PORTECO:
yagT
REGULONDB:
b0286
STRING:
511145.b0286
M3D: paoA
COLOMBOS: paoA
PortEco: b0286


Product      
Name: aldehyde dehydrogenase, Fe-S subunit
Synonym(s): PaoA, YagT
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 24.343
Isoelectric point: 5.779
Motif(s):
 
Type Positions Sequence
61 -> 137 MPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGL
1 -> 53 MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAATAVVYPHSTLAASVPA
54 -> 229 ATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGEIKS
66 -> 119 KVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNAC
133 -> 220 TIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAI

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0047770 - carboxylate reductase activity
GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0016903 - oxidoreductase activity, acting on the aldehyde or oxo group of donors
GO:0051537 - 2 iron, 2 sulfur cluster binding
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6157-MONOMER
ECOLIWIKI:
b0286
INTERPRO:
IPR036010
INTERPRO:
IPR036884
INTERPRO:
IPR012675
INTERPRO:
IPR001041
INTERPRO:
IPR002888
INTERPRO:
IPR006058
INTERPRO:
IPR006311
MODBASE:
P77165
PDB:
5G5H
PDB:
5G5G
PFAM:
PF01799
PFAM:
PF00111
PRIDE:
P77165
PROSITE:
PS51085
PROSITE:
PS00197
PROSITE:
PS51318
PROTEINMODELPORTAL:
P77165
REFSEQ:
NP_414820
SMR:
P77165
SWISSMODEL:
P77165
UNIPROT:
P77165


Operon      
Name: paoABCD         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_475 (cluster) 302957 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_476 302974 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB