RegulonDB RegulonDB 10.7: Gene Form
   

yagU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paoA yagU ykgJ paoB terminator TSS_476 TSS_476 TSS_475 (cluster) TSS_475 (cluster)

Gene      
Name: yagU    Texpresso search in the literature
Synonym(s): ECK0286, G6158, b0287
Genome position(nucleotides): 302991 --> 303605 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.2
External database links:  
ASAP:
ABE-0000995
ECHOBASE:
EB3330
OU-MICROARRAY:
b0287
PORTECO:
yagU
REGULONDB:
b0287
STRING:
511145.b0287
M3D: yagU
COLOMBOS: yagU
PortEco: b0287


Product      
Name: inner membrane protein that contributes to acid resistance
Synonym(s): YagU
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 22.967
Isoelectric point: 7.044
Motif(s):
 
Type Positions Sequence
26 -> 181 VVSAFVKWGAEVPLPPRSPVDMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGVTHIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWYENVSEIFGHLVWFWSIEI
133 -> 153 LLAGALAQLFVHMISFPLMGL
15 -> 35 GLAAFIGLIAGVVSAFVKWGA
101 -> 121 WVGVTHIIFSIVFAVGYCVVA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.4 - pH
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0010447 - response to acidic pH
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Hayes ET., et al., 2006
External database links:  
ECOCYC:
G6158-MONOMER
ECOLIWIKI:
b0287
INTERPRO:
IPR009898
PFAM:
PF07274
PRIDE:
P0AAA1
PROTEINMODELPORTAL:
P0AAA1
REFSEQ:
NP_414821
UNIPROT:
P0AAA1


Operon      
Name: yagU         
Operon arrangement:
Transcription unit        Promoter
yagU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_475 (cluster) 302957 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_476 302974 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hayes ET., Wilks JC., Sanfilippo P., Yohannes E., Tate DP., Jones BD., Radmacher MD., BonDurant SS., Slonczewski JL., 2006, Oxygen limitation modulates pH regulation of catabolism and hydrogenases, multidrug transporters, and envelope composition in Escherichia coli K-12., BMC Microbiol 6:89

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB