RegulonDB RegulonDB 10.7: Gene Form
   

ykgJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ecpE yagU ykgJ ecpD ykgJp3 ykgJp3 ykgJp2 ykgJp2

Gene      
Name: ykgJ    Texpresso search in the literature
Synonym(s): ECK0287, G6159, b0288
Genome position(nucleotides): 303853 <-- 304182 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.3
External database links:  
ASAP:
ABE-0000997
ECHOBASE:
EB4069
OU-MICROARRAY:
b0288
PORTECO:
ykgJ
REGULONDB:
b0288
STRING:
511145.b0288
M3D: ykgJ
COLOMBOS: ykgJ
PortEco: b0288


Product      
Name: putative zinc- or iron-chelating domain-containing protein YkgJ
Synonym(s): YkgJ, predicted ferredoxin
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 11.798
Isoelectric point: 8.419
Motif(s):
 
Type Positions Sequence
6 -> 98 PCMTCGACCAFFRVSFYWAEADDAGGTIPARLTEQISPFHRCMSGTNQKNPRCIALAGTPGKNACCTIYKNRSSTCREFAMSGENGVVNEACN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G6159-MONOMER
ECOLIWIKI:
b0288
INTERPRO:
IPR005358
PFAM:
PF03692
PRIDE:
P0AAL9
PROTEINMODELPORTAL:
P0AAL9
REFSEQ:
NP_414822
UNIPROT:
P0AAL9


Operon      
Name: ykgJ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ykgJp2 304258 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ykgJp3 304262 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB