RegulonDB RegulonDB 10.7: Gene Form
   

ecpE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ecpC ecpD ecpE ykgJ TSS_477 TSS_477 ykgJp3 ykgJp3 ykgJp2 ykgJp2

Gene      
Name: ecpE    Texpresso search in the literature
Synonym(s): ECK0288, G6160, b0289, matF, yagV
Genome position(nucleotides): 304495 <-- 305205 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.02
External database links:  
ASAP:
ABE-0001000
ECHOBASE:
EB3331
OU-MICROARRAY:
b0289
PORTECO:
yagV
REGULONDB:
b0289
STRING:
511145.b0289
M3D: ecpE
COLOMBOS: ecpE
PortEco: b0289


Product      
Name: putative fimbrial chaperone EcpE
Synonym(s): E. coli common pilus chaperone, EcpE, MatF, YagV
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 26.628
Isoelectric point: 9.823
Motif(s):
 
Type Positions Sequence
28 -> 236 ISVGNLTFSLPSETDFVSKRVVNNNKSARIYRIAISAIDSPGSSELRTRPVDGELLFAPRQLALQAGESEYFKFYYHGPRDNRERYYRVSFREVPTRNHTRRSPTGGVVSTEPVVVMDTILVVRPRQVQFKWSFDKVTGTVSNTGNTWFKLLIKPGCDSTEEEGDAWYLRPGDVVHQPELRQPGNHYLVYNDKFIKISDSCPAKPPSAD
1 -> 27 MFRRRGVTLTKALLTAVCMLAAPLTQA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
Note(s): Note(s): ...[more].
Reference(s): [1] Korea CG., et al., 2010
[2] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
G6160-MONOMER
ECOLIWIKI:
b0289
INTERPRO:
IPR008962
INTERPRO:
IPR013783
PRIDE:
P77263
PROTEINMODELPORTAL:
P77263
REFSEQ:
NP_414823
SMR:
P77263
UNIPROT:
P77263


Operon      
Name: ecpBCDE         
Operon arrangement:
Transcription unit        Promoter
 
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ykgJp2 304258 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ykgJp3 304262 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_477 305813 forward nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB