RegulonDB RegulonDB 10.7: Gene Form
   

ecpB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ecpC ecpB ecpA ecpD anti-terminator terminator matCp1 matCp1 matCp2 matCp2

Gene      
Name: ecpB    Texpresso search in the literature
Synonym(s): ECK0291, G6163, b0292, matC, yagY
Genome position(nucleotides): 309358 <-- 310026 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.86
External database links:  
ASAP:
ABE-0001007
ECHOBASE:
EB3334
OU-MICROARRAY:
b0292
PORTECO:
matC
REGULONDB:
b0292
STRING:
511145.b0292
M3D: ecpB
COLOMBOS: ecpB
PortEco: b0292


Product      
Name: putative fimbrial chaperone EcpB
Synonym(s): E. coli common pilus chaperone, EcpB, MatC, YagY
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 24.517
Isoelectric point: 9.823
Motif(s):
 
Type Positions Sequence
21 -> 222 LDVGDISSFMNSDSSTLSKTIKNSTDSGRLINIRLERLSSPLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEKERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQANYHFQYANGSLTNTGNATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK
150 -> 221 YHFQYANGSLTNTGNATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPV
1 -> 20 MKKHLLPLALLFSGISPAQA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
Reference(s): [1] Korea CG., et al., 2010
[2] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
G6163-MONOMER
ECOLIWIKI:
b0292
INTERPRO:
IPR008962
INTERPRO:
IPR013783
INTERPRO:
IPR040695
PDB:
5DFK
PFAM:
PF18649
PRIDE:
P77188
PROTEINMODELPORTAL:
P77188
REFSEQ:
NP_414826
SMR:
P77188
UNIPROT:
P77188


Operon      
Name: ecpBCDE         
Operon arrangement:
Transcription unit        Promoter
 
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835


RegulonDB