RegulonDB RegulonDB 10.7: Gene Form
   

ecpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ecpB ecpR ecpA anti-terminator terminator matBp5 matBp5 matCp1 matCp1 matCp2 matCp2

Gene      
Name: ecpA    Texpresso search in the literature
Synonym(s): ECK0292, G6164, b0293, matB, yagZ
Genome position(nucleotides): 310084 <-- 310671 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.89
External database links:  
ASAP:
ABE-0001009
ECHOBASE:
EB3335
OU-MICROARRAY:
b0293
PORTECO:
matB
REGULONDB:
b0293
STRING:
511145.b0293
M3D: ecpA
COLOMBOS: ecpA
PortEco: b0293


Product      
Name: common pilus major subunit
Synonym(s): E. coli common pilus - major subunit, ECP, EcpA, MatB, YagZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: pilus
Molecular weight: 20.111
Isoelectric point: 4.444
Motif(s):
 
Type Positions Sequence
26 -> 193 TAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATW
1 -> 22 MKKKVLAIALVTVFTGMGVAQA
23 -> 195 ADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
Note(s): Note(s): ...[more].
Evidence: [ICA] Inferred by computational analysis
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Lehti TA., et al., 2010
[3] Pouttu R., et al., 2001
[4] Rendon MA., et al., 2007
[5] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
G6164-MONOMER
ECOLIWIKI:
b0293
INTERPRO:
IPR016514
INTERPRO:
IPR038478
PDB:
3QS3
PFAM:
PF16449
PRIDE:
P0AAA3
PROTEINMODELPORTAL:
P0AAA3
REFSEQ:
NP_414827
SMR:
P0AAA3
UNIPROT:
P0AAA3


Operon      
Name: ecpA         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Activated by: MatA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Lehti TA., Bauchart P., Heikkinen J., Hacker J., Korhonen TK., Dobrindt U., Westerlund-Wikstrom B., 2010, Mat fimbriae promote biofilm formation by meningitis-associated Escherichia coli., Microbiology 156(Pt 8):2408-17

 [3] Pouttu R., Westerlund-Wikstrom B., Lang H., Alsti K., Virkola R., Saarela U., Siitonen A., Kalkkinen N., Korhonen TK., 2001, matB, a common fimbrillin gene of Escherichia coli, expressed in a genetically conserved, virulent clonal group., J Bacteriol 183(16):4727-36

 [4] Rendon MA., Saldana Z., Erdem AL., Monteiro-Neto V., Vazquez A., Kaper JB., Puente JL., Giron JA., 2007, Commensal and pathogenic Escherichia coli use a common pilus adherence factor for epithelial cell colonization., Proc Natl Acad Sci U S A 104(25):10637-42

 [5] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835


RegulonDB