RegulonDB RegulonDB 10.6.3: Gene Form
   

ykgM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ykgM ykgL ykgO ykgR Zur ykgMp ykgMp

Gene      
Name: ykgM    Texpresso search in the literature
Synonym(s): ECK0296, G6167, b0296
Genome position(nucleotides): 312514 <-- 312777 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.83
External database links:  
ASAP:
ABE-0001021
ECHOBASE:
EB4072
ECOCYC:
G6167
ECOLIHUB:
ykgM
OU-MICROARRAY:
b0296
REGULONDB:
b0296
STRING:
511145.b0296
M3D: ykgM
COLOMBOS: ykgM
PortEco: b0296


Product      
Name: putative ribosomal protein
Synonym(s): YkgM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,ribosome
Molecular weight: 9.92
Isoelectric point: 9.736
Motif(s):
 
Type Positions Sequence
1 -> 78 MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPYVTIDVSSKSHPFYTGKLRTVASEGNVARFTQRFG

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005840 - ribosome
molecular_function GO:0003735 - structural constituent of ribosome
biological_process GO:0006412 - translation
GO:0034224 - cellular response to zinc ion starvation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Graham AI., et al., 2009
[2] Graham AI., et al., 2012
[3] Makarova KS., et al., 2001
External database links:  
ECOCYC:
G6167-MONOMER
ECOLIWIKI:
b0296
INTERPRO:
IPR034704
INTERPRO:
IPR002150
INTERPRO:
IPR027493
MODBASE:
P0A7N1
PANTHER:
PTHR33280
PFAM:
PF01197
PRIDE:
P0A7N1
PRINTS:
PR01249
PRODB:
PRO_000023837
PROSITE:
PS01143
PROTEINMODELPORTAL:
P0A7N1
REFSEQ:
NP_414830
SMR:
P0A7N1
SWISSMODEL:
P0A7N1
UNIPROT:
P0A7N1


Operon      
Name: ykgMO         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Repressed by: Zur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Graham AI., Hunt S., Stokes SL., Bramall N., Bunch J., Cox AG., McLeod CW., Poole RK., 2009, Severe Zinc Depletion of Escherichia coli: roles for high affinity zinc binding by ZinT, zinc transport and zinc-independent proteins., J Biol Chem 284(27):18377-89

 [2] Graham AI., Sanguinetti G., Bramall N., McLeod CW., Poole RK., 2012, Dynamics of a starvation-to-surfeit shift: a transcriptomic and modelling analysis of the bacterial response to zinc reveals transient behaviour of the Fur and SoxS regulators., Microbiology 158(Pt 1):284-92

 [3] Makarova KS., Ponomarev VA., Koonin EV., 2001, Two C or not two C: recurrent disruption of Zn-ribbons, gene duplication, lineage-specific gene loss, and horizontal gene transfer in evolution of bacterial ribosomal proteins., Genome Biol 2(9):RESEARCH 0033


RegulonDB