RegulonDB RegulonDB 10.8: Gene Form
   

insE1 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insEF1 eaeH insF1 insE1 ykgR ykgP ykgA CRP terminator anti-terminator ykgRp ykgRp

Gene      
Name: insE1    Texpresso search in the literature
Synonym(s): ECK0298, G6168, b0298
Genome position(nucleotides): 315291 --> 315590 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0001028
OU-MICROARRAY:
b0298
PortEco:
insE-1
STRING:
511145.b2088
COLOMBOS: insE1


Product      
Name: IS3 element protein InsE
Synonym(s): InsE1
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.543
Isoelectric point: 10.57
Motif(s):
 
Type Positions Sequence
12 -> 78 RKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Sekine Y., et al., 1994
External database links:  
DIP:
DIP-47960N
ECOCYC:
G6534-MONOMER
ECOLIWIKI:
b0298
INTERPRO:
IPR002514
INTERPRO:
IPR009057
PFAM:
PF01527
PRIDE:
P0CF66
PRODB:
PRO_000023020
REFSEQ:
NP_414832
SMR:
P0CF66
UNIPROT:
P0CF66


Operon      
Name: eaeH-insE1EF1F1         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Sekine Y., Eisaki N., Ohtsubo E., 1994, Translational control in production of transposase and in transposition of insertion sequence IS3., J Mol Biol 235(5):1406-20


RegulonDB