RegulonDB RegulonDB 10.8: Gene Form
   

insF1 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insEF1 insF1 ykgA rclC insE1 ykgQ

Gene      
Name: insF1    Texpresso search in the literature
Synonym(s): ECK0299, G6169, b0299, tra5-5
Genome position(nucleotides): 315587 --> 316453 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.13
External database links:  
ASAP:
ABE-0001030
OU-MICROARRAY:
b0299
PortEco:
insF-1
STRING:
511145.b2089
COLOMBOS: insF1


Product      
Name: IS3 element protein InsF
Synonym(s): InsF1, Tra5-5
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.54
Isoelectric point: 10.145
Motif(s):
 
Type Positions Sequence
53 -> 101 VLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRK
124 -> 287 YASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACVESFFHSLKVECIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQFENKNL
127 -> 240 GPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACVESFFHSLKVE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0006310 - DNA recombination
GO:0032196 - transposition
GO:0015074 - DNA integration
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Sekine Y., et al., 1994
External database links:  
ECOCYC:
G7126-MONOMER
ECOLIWIKI:
b0299
ECOO157CYC:
Z1573-MONOMER
INTERPRO:
IPR012337
INTERPRO:
IPR036397
INTERPRO:
IPR025948
INTERPRO:
IPR001584
MODBASE:
P0CF79
PANTHER:
PTHR42648
PFAM:
PF00665
PFAM:
PF13276
PRIDE:
P0CF79
PRODB:
PRO_000023021
PROSITE:
PS50994
REFSEQ:
NP_414833
SMR:
P0CF79
UNIPROT:
P0CF79


Operon      
Name: eaeH-insE1EF1F1         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Sekine Y., Eisaki N., Ohtsubo E., 1994, Translational control in production of transposase and in transposition of insertion sequence IS3., J Mol Biol 235(5):1406-20


RegulonDB