RegulonDB RegulonDB 10.8: Gene Form
   

rclB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rclA rclC rclB ykgBp9 ykgBp9 ykgBp7 ykgBp7 ykgBp4 ykgBp4 ykgBp3 ykgBp3 ykgBp10 ykgBp10

Gene      
Name: rclB    Texpresso search in the literature
Synonym(s): ECK0302, G6173, b0303, ykgI
Genome position(nucleotides): 318331 <-- 318567 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
35.44
External database links:  
ASAP:
ABE-0001043
ECHOBASE:
EB4026
OU-MICROARRAY:
b0303
PortEco:
ykgI
STRING:
511145.b0303
COLOMBOS: rclB


Product      
Name: DUF1471 domain-containing protein RclB
Synonym(s): RclB, YkgI, putative protein, hypochlorite stress response
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,periplasmic space
Molecular weight: 8.472
Isoelectric point: 10.058
Motif(s):
 
Type Positions Sequence
30 -> 78 HISVSSVSASPTVLEDTIADIARKYNASSWKVTSMRIDNNSTATAVLYK
1 -> 22 MFKKSVLFATLLSGVMAFSTNA
23 -> 78 DDKIILKHISVSSVSASPTVLEDTIADIARKYNASSWKVTSMRIDNNSTATAVLYK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0042597 - periplasmic space
biological_process GO:1901530 - response to hypochlorite
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Parker BW., et al., 2013
External database links:  
ECOCYC:
G6173-MONOMER
ECOLIWIKI:
b0303
INTERPRO:
IPR025543
INTERPRO:
IPR036275
INTERPRO:
IPR010854
PFAM:
PF07338
PRIDE:
P75687
REFSEQ:
NP_414837
SMR:
P75687
UNIPROT:
P75687


Operon      
Name: rclABC         
Operon arrangement:
Transcription unit        Promoter
rclABC
 


Transcriptional Regulation      
Display Regulation             
Activated by: RclR


Regulation by small RNA    
  Display Regulation
small RNA omrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ykgBp10 318334 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ykgBp3 318376 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ykgBp4 318397 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ykgBp7 318484 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ykgBp9 318525 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Parker BW., Schwessinger EA., Jakob U., Gray MJ., 2013, The RclR protein is a reactive chlorine-specific transcription factor in Escherichia coli., J Biol Chem 288(45):32574-84

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB