RegulonDB RegulonDB 10.8: Gene Form
   

rclA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rclA rclR rclB anti-anti-terminator anti-terminator terminator ykgCp1 ykgCp1 ykgDp2 ykgDp2 ykgCp4 ykgCp4 ykgDp3 ykgDp3 ykgCp8 ykgCp8 TSS_478 TSS_478 ykgBp9 ykgBp9 ykgBp7 ykgBp7 ykgBp4 ykgBp4 ykgBp3 ykgBp3 ykgBp10 ykgBp10

Gene      
Name: rclA    Texpresso search in the literature
Synonym(s): ECK0303, G6174, b0304, ykgC
Genome position(nucleotides): 318676 <-- 320001 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.55
External database links:  
ASAP:
ABE-0001048
ECHOBASE:
EB3350
OU-MICROARRAY:
b0304
PortEco:
ykgC
STRING:
511145.b0304
COLOMBOS: rclA


Product      
Name: cupric reductase RclA
Synonym(s): RclA, YkgC, putative oxidoreductase with FAD/NAD(P)-binding domain and dimerization domain; hypochlorite stress response, putative pyridine nucleotide-disulfide oxidoreductase RclA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.244
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
5 -> 296 QAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCINIGCIPTKTLVHDAQQHTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVIDGQAEFINNHSLRVHRPEGNLEIHGEKIFINTGAQTVVPPIPGITTTPGVYDSTGLLNLKELPGHLGILGGGYIGVEFASMFANFGSKVTILEAASLFLPREDRDIADNIATILRDQGVDIILNAHVERISHHENQVQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERGAIVVDKRLHTTADNIWAMGDVTGG
33 -> 43 EQSNAMYGGTC
328 -> 434 VPYSVFMTPPLSRVGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRMLGASLLCVDSHEMINIVKMVMDAGLPYSILRDQIFTHPSMSESLN

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0008823 - cupric reductase activity
GO:0016491 - oxidoreductase activity
GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0050660 - flavin adenine dinucleotide binding
GO:0016668 - oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
GO:0042803 - protein homodimerization activity
biological_process GO:0045454 - cell redox homeostasis
GO:0055114 - oxidation-reduction process
GO:1901530 - response to hypochlorite
External database links:  
DIP:
DIP-12675N
ECOCYC:
G6174-MONOMER
ECOLIWIKI:
b0304
INTERPRO:
IPR004099
INTERPRO:
IPR036188
INTERPRO:
IPR023753
INTERPRO:
IPR016156
INTERPRO:
IPR012999
INTERPRO:
IPR001100
MINT:
MINT-1306527
MODBASE:
P77212
PDB:
6KOD
PDB:
6KYY
PDB:
6KGY
PFAM:
PF02852
PFAM:
PF07992
PRIDE:
P77212
PRINTS:
PR00368
PROSITE:
PS00076
REFSEQ:
NP_414838
SMR:
P77212
UNIPROT:
P77212


Operon      
Name: rclABC         
Operon arrangement:
Transcription unit        Promoter
rclABC
 


Transcriptional Regulation      
Display Regulation             
Activated by: RclR


RNA cis-regulatory element    
Attenuation: Transcriptional


Regulation by small RNA    
  Display Regulation
small RNA omrA, omrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ykgBp10 318334 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ykgBp3 318376 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ykgBp4 318397 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ykgBp7 318484 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ykgBp9 318525 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_478 320033 reverse nd [RS-EPT-CBR] [2]
  promoter ykgCp8 320088 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ykgDp3 320116 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ykgCp4 320170 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ykgDp2 320193 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB