RegulonDB RegulonDB 10.8: Gene Form
   

ykgE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ykgF rclR ykgE ykgG anti-anti-terminator anti-terminator terminator ykgEp10 ykgEp10 ykgEp7 ykgEp7 ykgEp8 ykgEp8 ykgEp9 ykgEp9

Gene      
Name: ykgE    Texpresso search in the literature
Synonym(s): ECK0305, G6176, b0306
Genome position(nucleotides): 321608 --> 322327 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.56
External database links:  
ASAP:
ABE-0001058
ECHOBASE:
EB3352
OU-MICROARRAY:
b0306
PortEco:
ykgE
STRING:
511145.b0306
COLOMBOS: ykgE


Product      
Name: putative lactate utilization oxidoreductase YkgE
Synonym(s): YkgE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.004
Isoelectric point: 7.629
Motif(s):
 
Type Positions Sequence
3 -> 84 VNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQPAINSGYIKEAIPGMKNLIAALEDNDDPIISPAGSCTYAV
133 -> 216 VYHPSCSLARKLGVKDEPLTLLKNVRGLELLTFAEQDTCCGFGGTFSVKMAEISGEMVKEKVAHLMEVRPEYLIGADVSCLLNI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004459 - L-lactate dehydrogenase activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Chai Y., et al., 2009
[2] Pinchuk GE., et al., 2009
External database links:  
ECOCYC:
G6176-MONOMER
ECOLIWIKI:
b0306
INTERPRO:
IPR004017
PFAM:
PF02754
PRIDE:
P77252
REFSEQ:
NP_414840
SMR:
P77252
UNIPROT:
P77252


Operon      
Name: ykgEFG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ykgEp9 321481 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ykgEp8 321484 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ykgEp7 321511 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ykgEp10 321537 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chai Y., Kolter R., Losick R., 2009, A widely conserved gene cluster required for lactate utilization in Bacillus subtilis and its involvement in biofilm formation., J Bacteriol 191(8):2423-30

 [2] Pinchuk GE., Rodionov DA., Yang C., Li X., Osterman AL., Dervyn E., Geydebrekht OV., Reed SB., Romine MF., Collart FR., Scott JH., Fredrickson JK., Beliaev AS., 2009, Genomic reconstruction of Shewanella oneidensis MR-1 metabolism reveals a previously uncharacterized machinery for lactate utilization., Proc Natl Acad Sci U S A 106(8):2874-9

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB