RegulonDB RegulonDB 10.8: Gene Form
   

ykgF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ykgF ykgE ykgG b0309 TSS_479 TSS_479

Gene      
Name: ykgF    Texpresso search in the literature
Synonym(s): ECK0306, G6177, b0307
Genome position(nucleotides): 322338 --> 323765 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.21
External database links:  
ASAP:
ABE-0001060
ECHOBASE:
EB3353
OU-MICROARRAY:
b0307
PortEco:
ykgF
STRING:
511145.b0307
COLOMBOS: ykgF


Product      
Name: putative amino acid dehydrogenase with NAD(P)-binding domain and ferridoxin-like domain
Synonym(s): YkgF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.052
Isoelectric point: 8.595
Motif(s):
 
Type Positions Sequence
72 -> 294 QLSEKVTQNGGHVYFARTKEDATRYILQVAQRKNARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRHQIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNEGNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAGHVDGPEEFHLVIV
303 -> 333 ASEFRDVLRCIRCGACMNTCPAYRHIGGHGY
309 -> 376 VLRCIRCGACMNTCPAYRHIGGHGYGSIYPGPIGAVISPLLGGYKDFKDLPYACSLCTACDNVCPVRI
385 -> 468 HRRVMAEKGITAKAEQRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGESFRSWFKKHQ
352 -> 381 YKDFKDLPYACSLCTACDNVCPVRIPLSKL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0004459 - L-lactate dehydrogenase activity
biological_process GO:0055114 - oxidation-reduction process
GO:0019516 - lactate oxidation
GO:1903457 - lactate catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6177-MONOMER
ECOLIWIKI:
b0307
INTERPRO:
IPR037171
INTERPRO:
IPR003741
INTERPRO:
IPR024185
INTERPRO:
IPR024569
INTERPRO:
IPR004452
INTERPRO:
IPR009051
INTERPRO:
IPR017896
INTERPRO:
IPR017900
MODBASE:
P77536
PANTHER:
PTHR47153
PFAM:
PF02589
PFAM:
PF13183
PFAM:
PF11870
PRIDE:
P77536
PROSITE:
PS51379
PROSITE:
PS00198
REFSEQ:
NP_414841
SMR:
P77536
UNIPROT:
P77536


Operon      
Name: ykgEFG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_479 324444 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB