RegulonDB RegulonDB 10.8: Gene Form
   

ykgG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ykgF ykgE ykgG ykgH b0309 TSS_479 TSS_479

Gene      
Name: ykgG    Texpresso search in the literature
Synonym(s): ECK0307, G6178, b0308
Genome position(nucleotides): 323758 --> 324453 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.16
External database links:  
ASAP:
ABE-0001062
ECHOBASE:
EB3354
OU-MICROARRAY:
b0308
PortEco:
ykgG
STRING:
511145.b0308
COLOMBOS: ykgG


Product      
Name: DUF162 domain-containing lactate utilization protein YkgG
Synonym(s): YkgG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.213
Isoelectric point: 4.673
Motif(s):
 
Type Positions Sequence
65 -> 228 TSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQQECNAVVWDPAKGAENISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPEYSLFILRKSTILPRVAQLAEKLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVKAVYLII

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004459 - L-lactate dehydrogenase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Chai Y., et al., 2009
External database links:  
ECOCYC:
G6178-MONOMER
ECOLIWIKI:
b0308
INTERPRO:
IPR024185
INTERPRO:
IPR037171
INTERPRO:
IPR003741
PFAM:
PF02589
PRIDE:
P77433
REFSEQ:
NP_414842
SMR:
P77433
UNIPROT:
P77433


Operon      
Name: ykgEFG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_479 324444 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chai Y., Kolter R., Losick R., 2009, A widely conserved gene cluster required for lactate utilization in Bacillus subtilis and its involvement in biofilm formation., J Bacteriol 191(8):2423-30

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB