RegulonDB RegulonDB 10.8: Gene Form
   

yahB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeL yahB yahC

Gene      
Name: yahB    Texpresso search in the literature
Synonym(s): ECK0314, G6181, b0316
Genome position(nucleotides): 333501 <-- 334433 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.3
External database links:  
ASAP:
ABE-0001088
ECHOBASE:
EB3356
OU-MICROARRAY:
b0316
PortEco:
yahB
STRING:
511145.b0316
COLOMBOS: yahB


Product      
Name: putative LysR-type DNA-binding transcriptional regulator YahB
Synonym(s): YahB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.866
Isoelectric point: 7.176
Motif(s):
 
Type Positions Sequence
5 -> 62 FTEENLLAFTTAARFGSFSKAAEELGLTTSAISYTIKRMETGLDVVLFTRSTRSIELT
22 -> 42 FSKAAEELGLTTSAISYTIKR
10 -> 66 LLAFTTAARFGSFSKAAEELGLTTSAISYTIKRMETGLDVVLFTRSTRSIELTESGR
91 -> 280 QGIEARVRICINQLLYTPKHTARLLQVLKKQFPTCQITVTTEVYNGVWDAIINNQANIAIGAPDTLLDGGGIDYTEIGAIRWAFAIAPDHPLAFVPEPIAESQLRLYPNIMVEDTAHTINKKVGWLLHGQESILVPDFNTKCQCQILGEGIGFLPDYMVREAMTQSLLVTRQIHNPRQDSRMLLATQHSA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0044212 - transcription regulatory region DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-11254N
ECOCYC:
G6181-MONOMER
ECOLIWIKI:
b0316
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR005119
INTERPRO:
IPR000847
MINT:
MINT-1294849
MODBASE:
P77700
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P77700
PROSITE:
PS50931
REFSEQ:
NP_414850
SMR:
P77700
UNIPROT:
P77700


Operon      
Name: yahB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50


RegulonDB