RegulonDB RegulonDB 10.8: Gene Form
   

yahO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prpR yahN yahO yahNp6 yahNp6 yahNp5 yahNp5 yahOp yahOp TSS_482 TSS_482

Gene      
Name: yahO    Texpresso search in the literature
Synonym(s): ECK0327, G6194, b0329
Genome position(nucleotides): 346484 --> 346759 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
38.77
External database links:  
ASAP:
ABE-0001130
ECHOBASE:
EB3368
OU-MICROARRAY:
b0329
PortEco:
yahO
STRING:
511145.b0329
COLOMBOS: yahO


Product      
Name: DUF1471 domain-containing protein YahO
Synonym(s): YahO
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 9.895
Isoelectric point: 5.881
Motif(s):
 
Type Positions Sequence
22 -> 91 AELMTKAEFEKVESQYEKIGDISTSNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTANIYKKK
37 -> 89 YEKIGDISTSNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTANIYK
1 -> 21 MKIISKMLVGALALAVTNVYA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
biological_process GO:0009314 - response to radiation
Note(s): Note(s): ...[more].
Reference(s): [1] Hamdallah I., et al., 2018
External database links:  
DIP:
DIP-11267N
ECOCYC:
G6194-MONOMER
ECOLIWIKI:
b0329
INTERPRO:
IPR025543
INTERPRO:
IPR036275
INTERPRO:
IPR010854
MINT:
MINT-1275385
PFAM:
PF07338
PRIDE:
P75694
REFSEQ:
NP_414863
SMR:
P75694
UNIPROT:
P75694


Operon      
Name: yahO         
Operon arrangement:
Transcription unit        Promoter
yahO


Regulation by small RNA    
  Display Regulation
small RNA omrA, omrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_482 346422 forward nd [RS-EPT-CBR] [2]
  promoter yahNp5 346435 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yahNp6 346436 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hamdallah I., Torok N., Bischof KM., Majdalani N., Chadalavada S., Mdluli N., Creamer KE., Clark M., Holdener C., Basting PJ., Gottesman S., Slonczewski JL., 2018, Experimental Evolution of Escherichia coli K-12 at High pH and with RpoS Induction., Appl Environ Microbiol 84(15)

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB