RegulonDB RegulonDB 10.6.3: Gene Form
   

prpR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prpR prpB yahO Cra CRP AscG PrpR AscG AscG AscG PrpR AscG PhoB prpBp prpBp prpRp prpRp

Gene      
Name: prpR    Texpresso search in the literature
Synonym(s): ECK0328, G6195, b0330, yahP
Genome position(nucleotides): 346857 <-- 348443 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.2
External database links:  
ASAP:
ABE-0001133
ECHOBASE:
EB3369
ECOCYC:
G6195
ECOLIHUB:
prpR
OU-MICROARRAY:
b0330
REGULONDB:
b0330
STRING:
511145.b0330
M3D: prpR
COLOMBOS: prpR
PortEco: b0330


Product      
Name: DNA-binding transcriptional dual regulator PrpR
Synonym(s): PrpR, YahP
Sequence: Get amino acid sequence Fasta Format
Regulator Family: EBP
Cellular location: cytosol
Molecular weight: 58.649
Isoelectric point: 8.434
Motif(s):
 
Type Positions Sequence
318 -> 327 AHGGTLFLDE
508 -> 527 KTAAANYLGISRTTFWRRLK
219 -> 393 LGQSPQMEQVRQTILLYARSSAAVLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAVNCGAIAESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQTRLLRVLEEKEVTRVGGHQPVPVDVRVISATHCNLEEDMQQGRFRRDLFYRLSILRL
36 -> 196 LANITPIQLGFEKAVTYIRKKLANERCDAIIAAGSNGAYLKSRLSVPVILIKPSGYDVLQALAKAGKLTSSIGVVTYQETIPALVAFQKTFNLRLDQRSYITEEDARGQINELKANGTEAVVGAGLITDLAEEAGMTGIFIYSAATVRQAFSDALDMTRMS
498 -> 527 QQALEKFNGDKTAAANYLGISRTTFWRRLK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0008134 - transcription factor binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000156 - phosphorelay response regulator activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
GO:0009314 - response to radiation
GO:0019629 - propionate catabolic process, 2-methylcitrate cycle
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Lee SK., et al., 2005
[2] Sargentini NJ., et al., 2016
External database links:  
DIP:
DIP-10582N
ECOCYC:
G6195-MONOMER
ECOLIWIKI:
b0330
INTERPRO:
IPR003593
INTERPRO:
IPR027417
INTERPRO:
IPR025944
INTERPRO:
IPR025943
INTERPRO:
IPR012704
INTERPRO:
IPR002078
INTERPRO:
IPR002197
INTERPRO:
IPR009057
INTERPRO:
IPR010524
MODBASE:
P77743
PDB:
2PJU
PFAM:
PF00158
PFAM:
PF02954
PFAM:
PF06506
PRIDE:
P77743
PRODB:
PRO_000023610
PROSITE:
PS50045
PROSITE:
PS00688
PROSITE:
PS00676
PROTEINMODELPORTAL:
P77743
REFSEQ:
NP_414864
SMART:
SM00382
SMR:
P77743
SWISSMODEL:
P77743
UNIPROT:
P77743


Operon      
Name: prpR         
Operon arrangement:
Transcription unit        Promoter
prpR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: PrpR, PhoB, AscG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Lee SK., Newman JD., Keasling JD., 2005, Catabolite repression of the propionate catabolic genes in Escherichia coli and Salmonella enterica: evidence for involvement of the cyclic AMP receptor protein., J Bacteriol 187(8):2793-800

 [2] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14


RegulonDB