RegulonDB RegulonDB 10.6.3: Gene Form
   

prpC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prpD prpC prpB

Gene      
Name: prpC    Texpresso search in the literature
Synonym(s): ECK0330, G6198, b0333, yahS, yzzD
Genome position(nucleotides): 350012 --> 351181 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.64
External database links:  
ASAP:
ABE-0001148
ECHOBASE:
EB1706
ECOCYC:
G6198
ECOLIHUB:
prpC
OU-MICROARRAY:
b0333
REGULONDB:
b0333
STRING:
511145.b0333
M3D: prpC
COLOMBOS: prpC
PortEco: b0333


Product      
Name: 2-methylcitrate synthase
Synonym(s): PrpC, YahS, YzzD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.102
Isoelectric point: 7.176
Motif(s):
 
Type Positions Sequence
22 -> 370 LSGVPAGNTALCTVGKSGNDLHYRGYDILDLAKHCEFEEVAHLLIHGKLPTRDELAAYKTKLKALRGLPANVRTVLEALPAASHPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPETDDDSIGGHFLHLLHGEKPSQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDMYSAIIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVENKEVVIGFGHPVYTIADPRHQVIKRVAKQLSQEGGSLKMYNIADRLETVMWESKKMFPNLDWFSAVSYNMMGVPTEMFTPLFVIARVTGWAAHIIEQRQDNKIIRP
268 -> 272 VVIGF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
Gene Ontology Terms (GO)  
cellular_component GO:0005759 - mitochondrial matrix
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0046912 - transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
GO:0004108 - citrate (Si)-synthase activity
GO:0050440 - 2-methylcitrate synthase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006099 - tricarboxylic acid cycle
GO:0019679 - propionate metabolic process, methylcitrate cycle
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10579N
ECOCYC:
G6198-MONOMER
ECOLIWIKI:
b0333
INTERPRO:
IPR036969
INTERPRO:
IPR024176
INTERPRO:
IPR019810
INTERPRO:
IPR002020
INTERPRO:
IPR011278
INTERPRO:
IPR016142
INTERPRO:
IPR016143
MODBASE:
P31660
PANTHER:
PTHR11739
PFAM:
PF00285
PRIDE:
P31660
PRINTS:
PR00143
PRODB:
PRO_000023607
PROSITE:
PS00480
PROTEINMODELPORTAL:
P31660
REFSEQ:
NP_414867
SMR:
P31660
UNIPROT:
P31660


Operon      
Name: prpBCDE         
Operon arrangement:
Transcription unit        Promoter
prpBCDE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PrpR
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB