RegulonDB RegulonDB 10.8: Gene Form
   

mhpR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mhpA lacI mhpR CRP MhpR CRP LacI anti-anti-terminator anti-terminator terminator mhpRp1 mhpRp1 mhpRp mhpRp mhpAp mhpAp lacIp lacIp

Gene      
Name: mhpR    Texpresso search in the literature
Synonym(s): ECK0343, G6201, b0346
Genome position(nucleotides): 367587 <-- 368420 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.76
Reference(s): [1] Torres B., et al., 2003
External database links:  
ASAP:
ABE-0001191
ECHOBASE:
EB4169
OU-MICROARRAY:
b0346
PortEco:
mhpR
STRING:
511145.b0346
COLOMBOS: mhpR


Product      
Name: DNA-binding transcriptional activator MhpR
Synonym(s): MhpR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: IclR
Cellular location: cytosol
Molecular weight: 31.322
Isoelectric point: 9.063
Motif(s):
 
Type Positions Sequence
89 -> 262 ISALAAPLLGDLLREVVWPTDVSTLDVDAMVVRETTHRFSRLSFHRAMVGRRLPLLKTASGLTWLAFCPEQDRKELIEMLASRPGDDYQLAREPLKLEAILARARKEGYGQNYRGWDQEEKIASIAVPLRSEQRVIGCLNLVYMASAMTIEQAAEKHLPALQRVAKQIEEGVES
256 -> 277 IEEGVESQAILVAGRRSGMHLR
15 -> 65 LTRGLMLLNMLNKLDGGASVGLLAELSGLHRTTVRRLLETLQEEGYVRRSP
135 -> 257 AMVGRRLPLLKTASGLTWLAFCPEQDRKELIEMLASRPGDDYQLAREPLKLEAILARARKEGYGQNYRGWDQEEKIASIAVPLRSEQRVIGCLNLVYMASAMTIEQAAEKHLPALQRVAKQIE
249 -> 249 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0019439 - aromatic compound catabolic process
GO:0045892 - negative regulation of transcription, DNA-templated
External database links:  
DIP:
DIP-10211N
ECOCYC:
G6201-MONOMER
ECOLIWIKI:
b0346
INTERPRO:
IPR029016
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR014757
INTERPRO:
IPR005471
MODBASE:
P77569
PFAM:
PF01614
PFAM:
PF09339
PRIDE:
P77569
PRODB:
PRO_000023234
PROSITE:
PS51077
PROSITE:
PS51078
REFSEQ:
NP_414880
SMART:
SM00346
SMR:
P77569
UNIPROT:
P77569


Operon      
Name: mhpR-lacI         
Operon arrangement:
Transcription unit        Promoter
lacI
mhpR-lacI
mhpR-lacI


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Torres B., Porras G., Garcia JL., Diaz E., 2003, Regulation of the mhp cluster responsible for 3-(3-hydroxyphenyl)propionic acid degradation in Escherichia coli., J Biol Chem 278(30):27575-85


RegulonDB